KEGG   Homo sapiens (human): 247Help
Entry
247               CDS       T01001                                 

Gene name
ALOX15B, 15-LOX-2
Definition
arachidonate 15-lipoxygenase, type B (EC:1.13.11.33)
Orthology
K08022  
arachidonate 15-lipoxygenase (second type) / 8-lipoxygenase (S-type) [EC:1.13.11.33 1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    247 (ALOX15B)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    247 (ALOX15B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     247 (ALOX15B)
    1.13.11.-  
     247 (ALOX15B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.1
AA seq 647 aa AA seqDB search
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKSTGIGIEGFSELIQRNMKQL
NYSLLCLPEDIRTRGVEDIPGYYYRDDGMQIWGAVERFVSEIIGIYYPSDESVQDDRELQ
AWVREIFSKGFLNQESSGIPSSLETREALVQYVTMVIFTCSAKHAAVSAGQFDSCAWMPN
LPPSMQLPPPTSKGLATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFT
EEAPRRSIATFQSRLAQISRGIQERNQGLVLPYTYLDPPLIENSVSI
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcagggtcagggtgtccaccggagaagccttcggggctggcacatgggac
aaagtgtctgtcagcatcgtggggacccggggagagagccccccactgcccctggacaat
ctcggcaaggagttcactgcgggcgctgaggaggacttccaggtgacgctcccggaggac
gtaggccgagtgctgctgctgcgcgtgcacaaggcgcccccagtgctgcccctgctgggg
cccctggccccggatgcctggttctgccgctggttccagctgacaccgccgcggggcggc
cacctcctcttcccctgctaccagtggctggagggggcggggaccctggtgctgcaggag
ggtacagccaaggtgtcctgggcagaccaccaccctgtgctccagcaacagcgccaggag
gagcttcaggcccggcaggagatgtaccagtggaaggcttacaacccaggttggcctcac
tgcctggatgaaaagacagtggaagacttggagctcaatatcaaatactccacagccaag
aatgccaacttttatctacaggctggctctgcttttgcagagatgaaaatcaaggggttg
ctggaccgcaaggggctctggaggagtctgaatgagatgaaaaggatcttcaacttccgg
aggaccccagcagctgagcacgcatttgagcactggcaggaggacgccttcttcgcctcc
cagttcctgaatggtctcaaccctgtcctgatccgccgctgtcactacctcccaaagaac
ttccccgtcactgatgccatggtggcctcagtgttgggtcctgggaccagcttgcaggct
gagctagagaagggctccctgttcttggtggatcacggcatcctctctggcatccagacc
aatgtcattaatgggaagcctcagttctctgcggccccaatgaccctgctataccagagc
ccaggctgcgggccgctgctgcctctcgccatccagctcagccagacccccggcccaaac
agccccatcttcctgcccactgatgacaagtgggactggttgctggccaagacctgggtg
cgcaatgccgagttctccttccatgaggccctcacgcacctgctgcactcacatctgctg
cctgaggtcttcaccctggctaccctgcgtcagctgccccactgccaccctctcttcaag
tccacaggcatcggcattgaaggcttctctgagttgatacagaggaacatgaagcagctg
aactattctctcctgtgtctgcctgaggatatccggacccgaggagttgaagacatccca
ggctactactaccgtgatgatgggatgcagatctggggtgcagtggaacgctttgtctct
gaaatcatcggtatctactacccaagtgatgagtctgtccaagatgacagagagctccag
gcctgggtcagagagatcttctccaagggcttcctaaaccaggagagctcaggtataccc
tcctcactggagacccgggaagccctggtgcagtatgtcaccatggtgatattcacctgc
tccgccaagcatgcggctgtcagtgcagggcagtttgactcctgtgcttggatgcccaac
ctgccacccagcatgcagctgccaccacccacctccaaaggcctggcaacatgcgagggc
ttcatagccaccctcccacctgtcaatgccacatgtgatgtcatccttgctctctggttg
ctgagcaaggagcctggagaccaaaggcccctgggcacctatccggatgagcacttcaca
gaggaggcccctcggcggagcatcgccaccttccagagccgcctggcccagatctcgagg
ggcatccaggagcggaaccagggcctggtgctgccctacacctacctagaccctcccctc
atcgagaacagcgtctccatctaa

DBGET integrated database retrieval system