KEGG   Homo sapiens (human): 248Help
Entry
248               CDS       T01001                                 

Gene name
ALPI, IAP
Definition
alkaline phosphatase, intestinal (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    248 (ALPI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     248 (ALPI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   248 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 528 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcgtc
atcccagctgaggaggagaacccggccttctggaaccgccaggcagctgaggccctggat
gctgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggc
gatgggttgggggtgcccacggtgacagccaccaggatcctaaaggggcagaagaatggc
aaactggggcctgagacgcccctggccatggaccgcttcccatacctggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaaggccaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaatgaggtcatctccgtgatgaaccgggccaagcaagcaggaaag
tcagtaggagtggtgaccaccacacgggtgcagcacgcctcgccagccggcacctacgca
cacacagtgaaccgcaactggtactcagatgctgacatgcctgcctcagcccgccaggag
gggtgccaggacatcgccactcagctcatctccaacatggacattgacgtgatccttggc
ggaggccgcaagtacatgtttcccatggggaccccagaccctgagtacccagctgatgcc
agccagaatggaatcaggctggacgggaagaacctggtgcaggaatggctggcaaagcac
cagggtgcctggtatgtgtggaaccgcactgagctcatgcaggcgtccctggaccagtct
gtgacccatctcatgggcctctttgagcccggagacacgaaatatgagatccaccgagac
cccacactggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aacccccgcggcttctacctctttgtggagggcggccgcatcgaccatggtcatcatgag
ggtgtggcttaccaggcactcactgaggcggtcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcaccgctgaccactcccatgtc
ttctcctttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgttc
aactcaggcgtgcgaccagacgtgaatgagagcgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgtttgcg
cgcggcccgcaggcgcacctggtgcatggtgtgcaggagcagagcttcgtagcgcatgtc
atggccttcgctgcctgtctggagccctacacggcctgcgacctggcgcctcccgcctgc
accaccgacgccgcgcacccagttgccgcgtcgctgccactgctggccgggaccctgctg
ctgctgggggcgtccgctgctccctga

DBGET integrated database retrieval system