KEGG   Homo sapiens (human): 249Help
Entry
249               CDS       T01001                                 

Gene name
ALPL, AP-TNAP, APTNAP, HOPS, TNAP, TNSALP
Definition
alkaline phosphatase, liver/bone/kidney (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Folate biosynthesis
Metabolic pathways
Disease
H00213  
Hypophosphatasia
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hsa00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.12
AA seq 524 aa AA seqDB search
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccattcttagtactggccattggcacctgccttactaactccttagtgcca
gagaaagagaaagaccccaagtactggcgagaccaagcgcaagagacactgaaatatgcc
ctggagcttcagaagctcaacaccaacgtggctaagaatgtcatcatgttcctgggagat
gggatgggtgtctccacagtgacggctgcccgcatcctcaagggtcagctccaccacaac
cctggggaggagaccaggctggagatggacaagttccccttcgtggccctctccaagacg
tacaacaccaatgcccaggtccctgacagcgccggcaccgccaccgcctacctgtgtggg
gtgaaggccaatgagggcaccgtgggggtaagcgcagccactgagcgttcccggtgcaac
accacccaggggaacgaggtcacctccatcctgcgctgggccaaggacgctgggaaatct
gtgggcattgtgaccaccacgagagtgaaccatgccacccccagcgccgcctacgcccac
tcggctgaccgggactggtactcagacaacgagatgccccctgaggccttgagccagggc
tgtaaggacatcgcctaccagctcatgcataacatcagggacattgacgtgatcatgggg
ggtggccggaaatacatgtaccccaagaataaaactgatgtggagtatgagagtgacgag
aaagccaggggcacgaggctggacggcctggacctcgttgacacctggaagagcttcaaa
ccgagatacaagcactcccacttcatctggaaccgcacggaactcctgacccttgacccc
cacaatgtggactacctattgggtctcttcgagccaggggacatgcagtacgagctgaac
aggaacaacgtgacggacccgtcactctccgagatggtggtggtggccatccagatcctg
cggaagaaccccaaaggcttcttcttgctggtggaaggaggcagaattgaccacgggcac
catgaaggaaaagccaagcaggccctgcatgaggcggtggagatggaccgggccatcggg
caggcaggcagcttgacctcctcggaagacactctgaccgtggtcactgcggaccattcc
cacgtcttcacatttggtggatacaccccccgtggcaactctatctttggtctggccccc
atgctgagtgacacagacaagaagcccttcactgccatcctgtatggcaatgggcctggc
tacaaggtggtgggcggtgaacgagagaatgtctccatggtggactatgctcacaacaac
taccaggcgcagtctgctgtgcccctgcgccacgagacccacggcggggaggacgtggcc
gtcttctccaagggccccatggcgcacctgctgcacggcgtccacgagcagaactacgtc
ccccacgtgatggcgtatgcagcctgcatcggggccaacctcggccactgtgctcctgcc
agctcggcaggcagccttgctgcaggccccctgctgctcgcgctggccctctaccccctg
agcgtcctgttctga

DBGET integrated database retrieval system