KEGG   Homo sapiens (human): 25Help
Entry
25                CDS       T01001                                 

Gene name
ABL1, ABL, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl
Definition
c-abl oncogene 1, non-receptor tyrosine kinase (EC:2.7.10.2)
Orthology
K06619  
abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Cell cycle
Axon guidance
Neurotrophin signaling pathway
Pathogenic Escherichia coli infection
Shigellosis
Pathways in cancer
MicroRNAs in cancer
Chronic myeloid leukemia
Viral myocarditis
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00004  
Chronic myeloid leukemia (CML)
Drug target
Imatinib: 
Dasatinib: 
Nilotinib: 
Bosutinib: 
Ponatinib: 
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 1130 aa AA seqDB search
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgttggagatctgcctgaagctggtgggctgcaaatccaagaaggggctgtcctcgtcc
tccagctgttatctggaagaagcccttcagcggccagtagcatctgactttgagcctcag
ggtctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaa
aatgaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactcta
agcataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgt
gaagcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaac
agtctggagaaacactcctggtaccatgggcctgtgtcccgcaatgccgctgagtatctg
ctgagcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccag
aggtccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttct
gatggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcat
catcattcaacggtggccgacgggctcatcaccacgctccattatccagccccaaagcgc
aacaagcccactgtctatggtgtgtcccccaactacgacaagtgggagatggaacgcacg
gacatcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggcgtg
tggaagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtg
gaagagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcag
ctccttggggtctgcacccgggagcccccgttctatatcatcactgagttcatgacctac
gggaacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctg
ctgtacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatc
cacagagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagct
gattttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaag
ttccccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtcc
gacgtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttac
ccgggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgc
ccagaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatcc
agtatctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagt
accttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcagag
cacagagacaccactgacgtgcctgagatgcctcactccaagggccagggagagagcgat
cctctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccccg
gagggcggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttc
agcgccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctcc
ttccgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagac
atcagcaacggggcactggctttcacccccttggacacagctgacccagccaagtcccca
aagcccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggc
ttccggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccacc
ggcgaggaggagggcggtggcagctccagcaagcgcttcctgcgctcttgctccgcctcc
tgcgttccccatggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttg
cagtccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccg
gctctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagta
acgcctccccccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagac
atcatggagtccagcccgggctccagcccgcccaacctgactccaaaacccctccggcgg
caggtcaccgtggcccctgcctcgggcctcccccacaaggaagaagctggaaagggcagt
gccttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggt
gcaccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcac
tcctctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccg
cccccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccag
gaggcggccggggaggcagtcctgggcgcaaagacaaaagccacgagtctggttgatgct
gtgaacagtgacgctgccaagcccagccagccgggagagggcctcaaaaagcccgtgctc
ccggccactccaaagccacagtccgccaagccgtcggggacccccatcagcccagccccc
gttccctccacgttgccatcagcatcctcggccctggcaggggaccagccgtcttccacc
gccttcatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagag
cggatcgccagcggcgccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgc
ctcgccatctctaggaactccgagcagatggccagccacagcgcagtgctggaggccggc
aaaaacctctacacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaag
tttgccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgc
ccggcgacagcaggcagtggtccagcggccactcaggacttcagcaagctcctcagttcg
gtgaaggaaatcagtgacatagtgcagaggtag

DBGET integrated database retrieval system