KEGG   Homo sapiens (human): 2530Help
Entry
2530              CDS       T01001                                 

Gene name
FUT8
Definition
fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (EC:2.4.1.68)
Orthology
K00717  
glycoprotein 6-alpha-L-fucosyltransferase [EC:2.4.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Metabolic pathways
Transcriptional misregulation in cancer
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - keratan sulfate [PATH:hsa00533]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 412 aa AA seqDB search
MTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQ
LHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKD
KNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLE
KEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKR
VYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFL
VCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPM
EPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctatactacctcagtcagacagatggagcaggtgattggcgggaaaaagag
gccaaagatctgacagaactggttcagcggagaataacatatcttcagaatcccaaggac
tgcagcaaagccaaaaagctggtgtgtaatatcaacaaaggctgtggctatggctgtcag
ctccatcatgtggtctactgcttcatgattgcatatggcacccagcgaacactcatcttg
gaatctcagaattggcgctatgctactggtggatgggagactgtatttaggcctgtaagt
gagacatgcacagacagatctggcatctccactggacactggtcaggtgaagtgaaggac
aaaaatgttcaagtggtcgagcttcccattgtagacagtcttcatccccgtcctccatat
ttacccttggctgtaccagaagacctcgcagatcgacttgtacgagtgcatggtgaccct
gcagtgtggtgggtgtctcagtttgtcaaatacttgatccgcccacagccttggctagaa
aaagaaatagaagaagccaccaagaagcttggcttcaaacatccagttattggagtccat
gtcagacgcacagacaaagtgggaacagaagctgccttccatcccattgaagagtacatg
gtgcatgttgaagaacattttcagcttcttgcacgcagaatgcaagtggacaaaaaaaga
gtgtatttggccacagatgacccttctttattaaaggaggcaaaaacaaagtaccccaat
tatgaatttattagtgataactctatttcctggtcagctggactgcacaatcgatacaca
gaaaattcacttcgtggagtgatcctggatatacattttctctctcaggcagacttccta
gtgtgtactttttcatcccaggtctgtcgagttgcttatgaaattatgcaaacactacat
cctgatgcctctgcaaacttccattctttagatgacatctactattttgggggccagaat
gcccacaatcaaattgccatttatgctcaccaaccccgaactgcagatgaaattcccatg
gaacctggagatatcattggtgtggctggaaatcattgggatggctattctaaaggtgtc
aacaggaaattgggaaggacgggcctatatccctcctacaaagttcgagagaagatagaa
acggtcaagtaccccacatatcctgaggctgagaaataa

DBGET integrated database retrieval system