KEGG   Homo sapiens (human): 2530Help
Entry
2530              CDS       T01001                                 

Gene name
FUT8
Definition
(RefSeq) fucosyltransferase 8
  KO
K00717  
glycoprotein 6-alpha-L-fucosyltransferase [EC:2.4.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Metabolic pathways
Transcriptional misregulation in cancer
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    2530 (FUT8)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    2530 (FUT8)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2530 (FUT8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.68  glycoprotein 6-alpha-L-fucosyltransferase
     2530 (FUT8)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   2530 (FUT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 575 aa AA seqDB search
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWR
EKEAKDLTELVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVVELPIVDSLHPR
PPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVI
GVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK
YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQ
TLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYS
KGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcggccatggactggttcctggcgttggattatgctcattctttttgcctgggggacc
ttgctgttttatataggtggtcacttggtacgagataatgaccatcctgatcactctagc
cgagaactgtccaagattctggcaaagcttgaacgcttaaaacaacagaatgaagacttg
aggcgaatggccgaatctctccggataccagaaggccctattgatcaggggccagctata
ggaagagtacgcgttttagaagagcagcttgttaaggccaaagaacagattgaaaattac
aagaaacagaccagaaatggtctggggaaggatcatgaaatcctgaggaggaggattgaa
aatggagctaaagagctctggtttttcctacagagtgaattgaagaaattaaagaactta
gaaggaaatgaactccaaagacatgcagatgaatttcttttggatttaggacatcatgaa
aggtctataatgacggatctatactacctcagtcagacagatggagcaggtgattggcgg
gaaaaagaggccaaagatctgacagaactggttcagcggagaataacatatcttcagaat
cccaaggactgcagcaaagccaaaaagctggtgtgtaatatcaacaaaggctgtggctat
ggctgtcagctccatcatgtggtctactgcttcatgattgcatatggcacccagcgaaca
ctcatcttggaatctcagaattggcgctatgctactggtggatgggagactgtatttagg
cctgtaagtgagacatgcacagacagatctggcatctccactggacactggtcaggtgaa
gtgaaggacaaaaatgttcaagtggtcgagcttcccattgtagacagtcttcatccccgt
cctccatatttacccttggctgtaccagaagacctcgcagatcgacttgtacgagtgcat
ggtgaccctgcagtgtggtgggtgtctcagtttgtcaaatacttgatccgcccacagcct
tggctagaaaaagaaatagaagaagccaccaagaagcttggcttcaaacatccagttatt
ggagtccatgtcagacgcacagacaaagtgggaacagaagctgccttccatcccattgaa
gagtacatggtgcatgttgaagaacattttcagcttcttgcacgcagaatgcaagtggac
aaaaaaagagtgtatttggccacagatgacccttctttattaaaggaggcaaaaacaaag
taccccaattatgaatttattagtgataactctatttcctggtcagctggactgcacaat
cgatacacagaaaattcacttcgtggagtgatcctggatatacattttctctctcaggca
gacttcctagtgtgtactttttcatcccaggtctgtcgagttgcttatgaaattatgcaa
acactacatcctgatgcctctgcaaacttccattctttagatgacatctactattttggg
ggccagaatgcccacaatcaaattgccatttatgctcaccaaccccgaactgcagatgaa
attcccatggaacctggagatatcattggtgtggctggaaatcattgggatggctattct
aaaggtgtcaacaggaaattgggaaggacgggcctatatccctcctacaaagttcgagag
aagatagaaacggtcaagtaccccacatatcctgaggctgagaaataa

DBGET integrated database retrieval system