KEGG   Homo sapiens (human): 2534Help
Entry
2534              CDS       T01001                                 

Gene name
FYN, SLK, SYN, p59-FYN
Definition
FYN oncogene related to SRC, FGR, YES (EC:2.7.10.2)
Orthology
K05703  
tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Osteoclast differentiation
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Cholinergic synapse
Prion diseases
Pathogenic Escherichia coli infection
Measles
Viral myocarditis
Class
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Neurodegenerative diseases; Prion diseases [PATH:hsa05020]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:hsa05416]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 537 aa AA seqDB search
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatccccaactacaacaacttccacgcagccgggggccaagga
ctcaccgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactctttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactacattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctatgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaacaaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgacttcggattggcccgattgatagaagacaatgagtac
acagcaagacaaggtgcaaagttccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctg
gaagactactttaccgcgacagagccccagtaccaacctggtgaaaacctgtaa

DBGET integrated database retrieval system