KEGG   Homo sapiens (human): 2535Help
Entry
2535              CDS       T01001                                 

Gene name
FZD2, Fz2, fz-2, fzE2, hFz2
Definition
frizzled class receptor 2
Orthology
K02235  
frizzled 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    2535 (FZD2)
   04390 Hippo signaling pathway
    2535 (FZD2)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2535 (FZD2)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    2535 (FZD2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2535 (FZD2)
   05205 Proteoglycans in cancer
    2535 (FZD2)
   05217 Basal cell carcinoma
    2535 (FZD2)
  Infectious diseases
   05166 HTLV-I infection
    2535 (FZD2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    2535 (FZD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
17q21.1
AA seq 565 aa AA seqDB search
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctagaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgtgagcgcgcgcgccagggc
tgcgaagccctcatgaacaagttcggttttcagtggcccgagcgcctgcgctgcgagcac
ttcccgcgccacggcgccgagcagatctgcgtcggccagaaccactccgaggacggagct
cccgcgctactcaccaccgcgccgccgccgggactgcagccgggtgccgggggcaccccg
ggtggcccgggcggcggcggcgctcccccgcgctacgccacgctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacctgcgcggcccgatggttccatgttcttctcacaggaggag
acgcgtttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcttccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatcgcgggcttcgtgctc
caggagcgcgtggtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgccg
gccgtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtaggcctcaacagcctggacccgctgcggggcttcgtgctagcgccgctc
ttcgtgtacctgttcatcggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgaaaagctggagcggctcatggtg
cgcatcggcgtcttctccgtgctctacacagtgcccgccaccatcgtcatcgcttgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccgacac
ggtgagaccaccgtgtga

DBGET integrated database retrieval system