KEGG   Homo sapiens (human): 255626Help
Entry
255626            CDS       T01001                                 

Gene name
HIST1H2BA, H2BFU, STBP, TH2B, TSH2B, TSH2B.1, bA317E16.3
Definition
(RefSeq) histone cluster 1 H2B family member a
  KO
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    255626 (HIST1H2BA)
  Immune diseases
   05322 Systemic lupus erythematosus
    255626 (HIST1H2BA)
  Substance dependence
   05034 Alcoholism
    255626 (HIST1H2BA)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    255626 (HIST1H2BA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   255626 (HIST1H2BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96A08(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
6p22.2
AA seq 127 aa AA seqDB search
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcatctaaaggtgctaccatttccaagaagggctttaagaaagctgtc
gttaagacccagaaaaaggaaggcaaaaagcgcaagaggacccgtaaggagagttattct
atttacatctacaaagtgctaaagcaggtccatccggacactggcatctcttcgaaagct
atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca
cgtttggctcactacagcaagcgctccaccatttcttccagagagattcagacagcagtg
cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc
actaagtacaccagctccaagtaa

DBGET integrated database retrieval system