KEGG   Homo sapiens (human): 255626Help
Entry
255626            CDS       T01001                                 

Gene name
HIST1H2BA, H2BFU, STBP, TSH2B, TSH2B.1, bA317E16.3
Definition
histone cluster 1, H2ba
Orthology
K11252  
histone H2B
Organism
hsa  Homo sapiens (human)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    255626 (HIST1H2BA)
  Immune diseases
   05322 Systemic lupus erythematosus
    255626 (HIST1H2BA)
  Substance dependence
   05034 Alcoholism
    255626 (HIST1H2BA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   255626 (HIST1H2BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p22.2
AA seq 127 aa AA seqDB search
MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcatctaaaggtgctaccatttccaagaagggctttaagaaagctgtc
gttaagacccagaaaaaggaaggcaaaaagcgcaagaggacccgtaaggagagttattct
atttacatctacaaagtgctaaagcaggtccatccggacactggcatctcttcgaaagct
atgagcattatgaattccttcgtcactgatatctttgagcgtatagcgagcgaggcatca
cgtttggctcactacagcaagcgctccaccatttcttccagagagattcagacagcagtg
cgcttgctactgccgggagagctggctaaacatgctgtgtctgagggcaccaaggctgtc
actaagtacaccagctccaagtaa

DBGET integrated database retrieval system