KEGG   Homo sapiens (human): 255631Help
Entry
255631            CDS       T01001                                 

Gene name
COL24A1
Definition
(RefSeq) collagen type XXIV alpha 1 chain
  KO
K19721  
collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    255631 (COL24A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   255631 (COL24A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q17RW2(Tdark)
UniProt: 
Position
1p22.3
AA seq 1714 aa AA seqDB search
MHLRAHRTRRGKVSPTAKTKSLLHFIVLCVAGVVVHAQEQGIDILHQLGLGGKDVRHSSP
ATAVPSASTPLPQGVHLTESGVIFKNDAYIETPFVKILPVNLGQPFTILTGLQSHRVNNA
FLFSIRNKNRLQLGVQLLPKKLVVHIRGKQPAVFNYSVHDEQWHSFAITIRNQSVSMFVE
CGKKYFSTETIPEVQTFDSNSVFTLGSMNNNSIHFEGIVCQLDIIPSAEASADYCRYVKQ
QCRQADKYQPETSIPCTTLIPTKIPEHSPPPKLFAEKVLSEDTFTEGKSIPNIIKNDSET
VYKRQEHQISRSQLSSLQSGNVSAVDLTNHGIQAKEMITEEDTQTNFSLSVTTHRISEAK
MNTKEKFSSLLNMSDNITQHDDRVTGLSLFKKMPSILPQIKQDTITNLKKAITANLHTNE
LMEMQPILNTSLHRVTNEPSVDNHLDLRKEGEFYPDATYPIENSYETELYDYYYYEDLNT
MLEMEYLRGPKGDTGPPGPPGPAGIPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPG
FSPGQPVPGEKGDQGLSGLMGPPGMQGDKGLKGHPGLPGLPGEQGIPGFAGNIGSPGYPG
RQGLAGPEGNPGPKGAQGFIGSPGEAGQLGPEGERGIPGIRGKKGFKGRQGFPGDFGDRG
PAGLDGSPGLVGGTGPPGFPGLRGSVGPVGPIGPAGIPGPMGLSGNKGLPGIKGDKGEQG
TAGELGEPGYPGDKGAVGLPGPPGMRGKSGPSGQTGDPGLQGPSGPPGPEGFPGDIGIPG
QNGPEGPKGLLGNRGPPGPPGLKGTQGEEGPIGAFGELGPRGKPGQKGYAGEPGPEGLKG
EVGDQGNIGKIGETGPVGLPGEVGMTGSIGEKGERGSPGPLGPQGEKGVMGYPGPPGVPG
PIGPLGLPGHVGARGPPGSQGPKGQRGSRGPDGLLGEQGIQGAKGEKGDQGKRGPHGLIG
KTGNPGERGFQGKPGLQGLPGSTGDRGLPGEPGLRGLQGDVGPPGEMGMEGPPGTEGESG
LQGEPGAKGDVGTAGSVGGTGEPGLRGEPGAPGEEGLQGKDGLKGVPGGRGLPGEDGEKG
EMGLPGIIGPLGRSGQTGLPGPEGIVGIPGQRGRPGKKGDKGQIGPTGEVGSRGPPGKIG
KSGPKGARGTRGAVGHLGLMGPDGEPGIPGYRGHQGQPGPSGLPGPKGEKGYPGEDSTVL
GPPGPRGEPGPVGDQGERGEPGAEGYKGHVGVPGLRGATGQQGPPGEPGDQGEQGLKGER
GSEGNKGKKGAPGPSGKPGIPGLQGLLGPKGIQGYHGADGISGNPGKIGPPGKQGLPGIR
GGPGRTGLAGAPGPPGVKGSSGLPGSPGIQGPKGEQGLPGQPGIQGKRGHRGAQGDQGPC
GDPGLKGQPGEYGVQGLTGFQGFPGPKGPEGDAGIVGISGPKGPIGHRGNTGPLGREGII
GPTGRTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRKQMDINAAIQALIESNTALQM
ESYQNTEVTLIDHSEEIFKTLNYLSNLLHSIKNPLGTRDNPARICKDLLNCEQKVSDGKY
WIDPNLGCPSDAIEVFCNFSAGGQTCLPPVSVTKLEFGVGKVQMNFLHLLSSEATHIITI
HCLNTPRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFH
TQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
NT seq 5145 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaagagcccacagaacaaggcgtggaaaagtctcccccacggcaaaaacgaaa
tcacttcttcattttattgtactatgtgtggctggggtggttgttcatgcacaagaacaa
ggcatagatattcttcatcaactaggccttggaggcaaagacgtaagacactcatcacca
gcgactgctgtaccatcagcatctacaccgttacctcagggggtccatttaacagaatca
ggagtcatttttaaaaatgatgcttatatcgagacacctttcgtgaaaattttaccagtc
aacttggggcagccgtttacaatattaactgggttacagtcacatcgggtgaacaatgca
tttctcttcagcattagaaataaaaatagactgcaattaggagtacaattactacctaaa
aaattagtagtacacattagaggaaagcagcctgcagttttcaactacagtgttcatgat
gagcaatggcactcatttgccattactattagaaaccaaagtgtctcaatgtttgttgag
tgtggaaagaaatattttagcacagagactattccagaagttcagacctttgattctaat
agtgtgtttactttaggaagtatgaataataattctatccattttgaaggaatagtatgt
cagttagatattattccttctgcagaagcatctgcagactactgcagatatgtgaaacag
cagtgtcgccaagcagacaaataccaacctgaaacaagcattccttgtacaactctcata
ccaacaaagataccggaacactctcccccgcccaaactatttgctgaaaaagtactgtca
gaggatacatttactgaaggcaaaagcattccaaatatcataaaaaatgattctgaaacc
gtgtataaaagacaagaacaccagatatcaagatctcagttatcttctcttcagtcagga
aatgtctctgctgtggatctcacaaaccatgggattcaggccaaagaaatgatcactgag
gaagatactcagacaaatttcagcctgtcagtgaccactcatcgcatcagtgaggcaaaa
atgaataccaaagagaaatttagctctctcctaaacatgtctgacaatatcacacaacat
gatgatagagtaactggtctgtcactgtttaagaagatgccatctattcttccacaaatt
aaacaagatacaattactaatctcaagaaggctatcacagcaaatctacacactaacgaa
ctcatggaaatgcaaccaattttaaacacaagcttgcatagagtgacaaatgagccatct
gtggataatcaccttgatctaaggaaagaaggtgaattttatcctgatgctacttatccc
atcgaaaatagctatgaaactgagctttatgattattattattatgaggatctaaataca
atgcttgaaatggagtatctgagagggccaaaaggagacactggacctcccggtccacct
ggtccagcaggtatcccaggtccgtcagggaagagaggtccacggggcataccagggcca
catggaaatcctggtttacctggattacctggtccaaagggccccaaaggagatccagga
ttttccccaggtcaacctgttcctggagaaaagggtgatcaaggcctttctggattaatg
ggcccccctggtatgcaaggtgataagggtctcaaaggacatcctggactcccaggactt
ccaggtgaacaaggaattccaggatttgctggtaatattggttcacccggttaccctggc
aggcagggtttagctggaccagaaggtaatccaggtcctaaaggtgcacaaggttttatt
ggctctcctggagaagcgggacaactgggacctgaaggagaacggggcattcctgggatc
cgtggaaagaagggttttaaggggagacagggttttccaggtgactttggagacagaggc
cctgctggtcttgatggcagtcctggacttgtaggtggcactggtcctccggggtttcct
gggcttagaggcagtgttggccctgtgggaccaattggacctgctggaattcctggccca
atgggcctttcagggaataaaggactacctggaatcaaaggtgataagggtgaacaaggc
acagcaggagagctaggagaacccgggtatcctggagacaagggtgctgttggtttacca
ggaccaccagggatgagaggaaagtcagggccttcaggccaaacaggtgacccaggactc
caaggaccatctggccctccaggaccagagggttttccaggagatattgggattcctgga
caaaacggccctgaaggaccaaagggactccttggaaatagaggacctcctggacctcct
ggtctcaaaggaactcagggagaagaaggaccaattggagcctttggggaactggggcca
agaggaaaaccaggtcaaaaggggtatgcaggtgaaccaggaccagaaggcttaaaggga
gaagtaggagatcaaggaaatattggaaaaattggtgaaacaggacctgttggcttacct
ggagaagttgggatgactggaagcattggcgaaaagggagaacgtggaagtccaggccca
ctaggtccgcagggagaaaaaggtgttatgggatatccaggtcctcctggggttccagga
cctatcggtccattgggattacctggtcatgtgggggcaagaggaccacctgggagtcaa
ggtcctaaaggacaaagaggatcaagaggaccagatggtctcttaggggaacaaggtata
caaggtgccaagggtgaaaaaggagatcaaggaaaaagagggcctcatggtcttattggt
aagactggaaaccctggagaaagaggatttcaagggaaaccaggtttacagggattgcct
ggaagtacaggtgacagaggacttccaggagagccaggactgcgaggactgcaaggtgat
gttggacctcctggagaaatgggcatggagggacctccaggcactgagggagagtctggt
ctgcaaggtgaaccaggtgcaaagggagatgttggaactgctggcagtgttggaggaact
ggggaaccaggtttacggggtgaaccaggagctcctggagaagaaggtctccagggaaaa
gatgggttaaagggagtaccaggaggaaggggacttcctggagaggatggagaaaaagga
gagatgggcttaccaggaattataggacccttgggtagatcaggccaaacaggccttccg
ggacctgaaggaattgtgggaattccagggcaaagaggtcgtccaggaaaaaagggtgat
aaaggacaaataggacccacaggagaagttggaagcagaggtcctcctggaaaaattggg
aaaagtggtcctaagggtgccagaggaactagaggtgctgtgggacatttaggattgatg
ggacctgatggagaaccaggaattccagggtacaggggccatcagggccaaccaggaccc
tctggattgccaggacctaaaggagaaaagggctacccaggagaagatagcacagtccta
ggaccacctgggcctcgaggtgaaccaggtccagtgggggaccaaggagagagaggagag
cctggagcagagggatataagggccatgtgggtgtaccaggactaagaggtgccactgga
caacaaggacccccaggcgaaccaggtgaccagggtgaacaaggactaaaaggagagaga
ggatctgaaggtaataaggggaaaaaaggagctcctggtccttctgggaaacctgggatt
cctggacttcaaggcctacttgggccaaaaggcatacaaggataccatggagcagatggc
atttcaggaaaccctggaaaaattgggccaccaggaaaacagggacttcctggcatcaga
ggcggcccaggaagaacaggtcttgctggggctccaggtcctccaggagtaaagggttca
tcaggcttgccaggaagcccaggaattcaaggcccaaagggtgaacaagggctacctggt
caacctggaattcaaggtaaaagaggtcaccgaggagcacaaggtgatcaaggaccatgt
ggagaccctggcctgaaagggcagcctggagaatatggtgttcaaggtttgacaggtttc
caaggattcccaggccctaaaggtcctgaaggggatgctggcattgttgggatatcaggt
cctaaaggtcctattggacacagaggaaacactggtccccttggcagagaaggtataata
ggcccaacaggtagaactggacccagaggtgaaaagggctttagaggtgaaactggtcct
caaggaccaagaggtcaaccagggcctccaggtccacctggagcaccaggcccaagaaag
caaatggatatcaatgctgctattcaagccttgattgaatcaaatactgccctacagatg
gagagctaccagaatactgaagtgactttaattgaccacagtgaagagatattcaaaacc
ctgaactaccttagcaatttattgcacagcatcaagaatcctcttggcacacgagataac
ccagcacgaatctgcaaagatttacttaactgtgaacaaaaagtatcagatggaaaatac
tggattgacccaaatcttggctgtccttcagatgccattgaggttttctgcaatttcagt
gctggtggccagacatgcttacctcctgtttctgtaacaaagttggagtttggagttggg
aaagtccagatgaacttccttcatttactgagttcggaagccacccatatcatcaccatt
cactgtctaaacaccccaaggtggacaagcacacaaacaagtggcccaggattgcctatt
ggtttcaagggatggaatggccagatttttaaagtaaacactctacttgaacctaaagtg
ctttcagatgactgcaagattcaagatggcagctggcataaggcaacatttctttttcac
acccaggaacctaatcaacttccagtgattgaagtacaaaaacttcctcatctcaaaact
gaacgaaagtattacattgacagcagttctgtatgctttctgtaa

DBGET integrated database retrieval system