KEGG   Homo sapiens (human): 2566Help
Entry
2566              CDS       T01001                                 

Gene name
GABRG2, CAE2, ECA2, GEFSP3
Definition
gamma-aminobutyric acid (GABA) A receptor, gamma 2
Orthology
K05186  
gmma-aminobutyric acid receptor subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Disease
H00783  
Febrile seizures
H00808  
Idiopathic generalized epilepsies (IGEs)
Drug target
Hexobarbital: 
Thiopental: 
Propofol: 
Methylphenobarbital: 
Phenobarbital: 
Clonazepam: 
Aminobutyric acid: 
Diazepam: 
Chlordiazepoxide: 
Medazepam: 
Oxazepam: 
Potassium clorazepate: 
Lorazepam: 
Adinazolam: 
Bromazepam: 
Clobazam: 
Prazepam: 
Alprazolam: 
Nordazepam: 
Fludiazepam: 
Ethyl loflazepate: 
Etizolam: 
Clotiazepam: 
Cloxazolam: 
Tofisopam: 
Meprobamate: 
Pentobarbital: 
Amobarbital: 
Barbital: 
Secobarbital: 
Flurazepam: 
Nitrazepam: 
Flunitrazepam: 
Estazolam: 
Triazolam: 
Lormetazepam: 
Temazepam: 
Midazolam: 
Brotizolam: 
Quazepam: 
Loprazolam: 
Glutethimide: 
Zopiclone: 
Zolpidem: 
Eszopiclone: 
Methaqualone: 
Pentetrazol: 
Flumazenil: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2566 (GABRG2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2566 (GABRG2)
   04723 Retrograde endocannabinoid signaling
    2566 (GABRG2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2566 (GABRG2)
   05033 Nicotine addiction
    2566 (GABRG2)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2566 (GABRG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q34
AA seq 467 aa AA seqDB search
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgccaaatatatggagcacaggaagctcagtctactcgactcctgtattttca
cagaaaatgacggtgtggattctgctcctgctgtcgctctaccctggcttcactagccag
aaatctgatgatgactatgaagattatgcttctaacaaaacatgggtcttgactccaaaa
gttcctgagggtgatgtcactgtcatcttaaacaacctgctggaaggatatgacaataaa
cttcggcctgatataggagtgaagccaacgttaattcacacagacatgtatgtgaatagc
attggtccagtgaacgctatcaatatggaatacactattgatatattttttgcgcaaacg
tggtatgacagacgtttgaaatttaacagcaccattaaagtcctccgattgaacagcaac
atggtggggaaaatctggattccagacactttcttcagaaattccaaaaaagctgatgca
cactggatcaccacccccaacaggatgctgagaatttggaatgatggtcgagtgctctac
accctaaggttgacaattgatgctgagtgccaattacaattgcacaactttccaatggat
gaacactcctgccccttggagttctccagttatggctatccacgtgaagaaattgtttat
caatggaagcgaagttctgttgaagtgggcgacacaagatcctggaggctttatcaattc
tcatttgttggtctaagaaataccaccgaagtagtgaagacaacttccggagattatgtg
gtcatgtctgtctactttgatctgagcagaagaatgggatactttaccatccagacctat
atcccctgcacactcattgtcgtcctatcctgggtgtctttctggatcaataaggatgct
gttccagccagaacatctttaggtatcaccactgtcctgacaatgaccaccctcagcacc
attgcccggaaatcgctccccaaggtctcctatgtcacagcgatggatctctttgtatct
gtttgtttcatctttgtcttctctgctctggtggagtatggcaccttgcattattttgtc
agcaaccggaaaccaagcaaggacaaagataaaaagaagaaaaaccctgcccctaccatt
gatatccgcccaagatcagcaaccattcaaatgaataatgctacacaccttcaagagaga
gatgaagagtacggctatgagtgtctggacggcaaggactgtgccagttttttctgctgt
tttgaagattgtcgaacaggagcttggagacatgggaggatacatatccgcattgccaaa
atggactcctatgctcggatcttcttccccactgccttctgcctgtttaatctggtctat
tgggtctcctacctctacctgtga

DBGET integrated database retrieval system