KEGG   Homo sapiens (human): 2567Help
Entry
2567              CDS       T01001                                 

Gene name
GABRG3
Definition
(RefSeq) gamma-aminobutyric acid type A receptor gamma3 subunit
  KO
K05186  
gamma-aminobutyric acid receptor subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Drug target
Abecarnil: 
Adinazolam (DG00911): 
Adipiplon: 
Alprazolam: 
Aminobutyric acid: 
Amobarbital (DG00916): 
Barbital: 
Bretazenil: 
Bromazepam: 
Brotizolam: 
Chlordiazepoxide (DG00908): 
Clobazam: 
Clonazepam: 
Clotiazepam: 
Cloxazolam: 
Delorazepam: 
Dextofisopam: 
Diazepam: 
Estazolam: 
Eszopiclone: 
Ethyl loflazepate: 
Etizolam: 
Fludiazepam: 
Flumazenil: 
Flunitrazepam: 
Flurazepam (DG00919): 
Flutazolam: 
Flutoprazepam: 
Gaboxadol: 
Ganaxolone: 
Glutethimide: 
Haloxazolam: 
Hexobarbital: 
Indiplon: 
Iomazenil: 
Levotofisopam: 
Loprazolam (DG00921): 
Lorazepam: 
Lormetazepam: 
Medazepam (DG00909): 
Meprobamate: 
Methaqualone: 
Methylphenobarbital: 
Mexazolam: 
Midazolam (DG00920): 
Nimetazepam: 
Nitrazepam: 
Nordazepam: 
Ocinaplon: 
Oxazepam: 
Oxazolam: 
Pagoclone: 
Pentetrazol: 
Pentobarbital (DG00915): 
Phenobarbital (DG00845): 
Potassium clorazepate (DG01218): 
Prazepam: 
Propofol (DG00797): 
Quazepam: 
Remimazolam besilate: 
Rilmazafone (DG01307): 
Sarmazenil: 
Secobarbital (DG00917): 
Temazepam: 
Thiamylal (DG01377): 
Thiopental (DG00790): 
Tofisopam: 
Triazolam: 
Zolpidem (DG00922): 
Zopiclone: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2567 (GABRG3)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    2567 (GABRG3)
   04723 Retrograde endocannabinoid signaling
    2567 (GABRG3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2567 (GABRG3)
   05033 Nicotine addiction
    2567 (GABRG3)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  GABA-A
   2567 (GABRG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q12
AA seq 467 aa AA seqDB search
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS
TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS
SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC
YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaagctgctgctcctcctctgcctgttctcgggcttgcacgcgcggtccaga
aaggtggaagaggatgaatatgaagattcatcatcaaaccaaaagtgggtcttggctcca
aaatcccaagacaccgacgtgactcttattctcaacaagttgctaagagaatatgataaa
aagctgaggccagatattggaataaaaccgaccgtaattgacgttgacatttatgttaac
agcattggtcctgtgtcatcaataaacatggaataccaaattgacatattttttgctcag
acctggacagatagtcgccttcgattcaacagcacaatgaaaattcttactctgaacagc
aacatggtggggttaatctggatcccagacaccatcttccgcaattctaaaaccgcagag
gctcactggatcaccacacccaatcagctcctccggatttggaatgacgggaaaatcctt
tacactttgaggctcaccatcaatgctgagtgccagctgcagctgcacaacttccccatg
gacgaacactcctgcccgctgattttctccagctatggctatcccaaagaagaaatgatt
tatagatggagaaaaaattcagtggaggcagctgaccagaaatcatggcggctttatcag
tttgacttcatgggcctcagaaacaccacagaaatcgtgacaacgtctgcaggtgattat
gttgtcatgactatatattttgaattgagtagaagaatgggatacttcaccattcagaca
tacattccctgtatactgactgtggttttatcctgggtgtcattttggatcaaaaaagat
gctacgccagcaagaacagcattaggcatcaccacggtgctgaccatgaccaccctgagc
accatcgccaggaagtccttgccacgcgtgtcctacgtgaccgccatggacctttttgtg
accgtgtgcttcctgtttgtcttcgccgcgctgatggagtatgccaccctcaactactat
tccagctgtagaaaaccaaccaccacgaagaagacaacatcgttactacatccagattcc
tcaagatggattcctgagcgaataagcctacaagccccttccaactattccctcctggac
atgaggccaccaccaactgcgatgatcactttaaacaattccgtttactggcaggaattt
gaagatacctgtgtctatgagtgtctggatggcaaagactgtcagagcttcttctgctgc
tatgaagaatgtaaatcaggatcctggaggaaagggcgtattcacatagacatcttggag
ctggactcgtactcccgggtctttttccccacgtccttcctgctctttaacctggtctac
tgggttggatacctgtatctctaa

DBGET integrated database retrieval system