KEGG   Homo sapiens (human): 25834Help
Entry
25834             CDS       T01001                                 

Gene name
MGAT4C, GNTIVH, HGNT-IV-H
Definition
MGAT4 family, member C (EC:2.4.1.145)
Orthology
K13748  
alpha-1,3-mannosylglycoprotein beta-1,4-N-acetylglucosaminyltransferase C [EC:2.4.1.201 2.4.1.145]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    25834 (MGAT4C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.145  alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     25834 (MGAT4C)
    2.4.1.201  alpha-1,6-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
     25834 (MGAT4C)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  N-Glycan
   25834 (MGAT4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
12q21
AA seq 478 aa AA seqDB search
MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETS
THQLNSERYVHTFKDLSNFSGAINVTYRYLAATPLQRKRYLTIGLSSVKRKKGNYLLETI
KSIFEQSSYEELKEISVVVHLADFNSSWRDAMVQDITQKFAHHIIAGRLMVIHAPEEYYP
ILDGLKRNYNDPEDRVKFRSKQNVDYAFLLNFCANTSDYYVMLEDDVRCSKNFLTAIKKV
IASLEGTYWVTLEFSKLGYIGKLYHSHDLPRLAHFLLMFYQEMPCDWLLTHFRGLLAQKN
VIRFKPSLFQHMGYYSSYKGTENKLKDDDFEEESFDIPDNPPASLYTNMNVFENYEASKA
YSSVDEYFWGKPPSTGDVFVIVFENPIIIKKIKVNTGTEDRQNDILHHGALDVGENVMPS
KQRRQCSTYLRLGEFKNGNFEMSGVNQKIPFDIHCMRIYVTKTQKEWLIIRSISIWTS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatttcatcaaatgaaacatatttttgaaatacttgataaaatgagatgcctg
agaaaacgttctacagtgtcattcttgggagttcttgtcatttttctcctttttatgaac
ttgtacattgaagatagctatgttctggaaggagacaaacaacttataagggaaacatcc
acacatcaactgaattcagaacgctatgttcatactttcaaggatttatctaatttctca
ggagccataaatgtcacctatcgctacctagctgccacacctttacaaagaaagcggtat
cttacaattggactttcttcagtaaagcgaaaaaaaggaaactatttacttgagacaatt
aagtcaatttttgagcaatccagctatgaagagctgaaggaaatttcagtggtggttcac
ctagcagactttaattcttcctggcgtgatgccatggtccaggatattacacagaaattt
gcgcaccatattattgcaggaagattaatggttatacatgctccagaggagtattaccca
atcctagatggccttaaaagaaattacaatgatccagaagatagagtcaaatttcgttcc
aagcaaaatgtagattatgcttttctgcttaatttttgtgccaatacttcagactattat
gtaatgcttgaagatgatgttcgatgttcaaaaaatttcttaactgccatcaagaaagtc
attgcatccctagaaggaacttactgggtaactcttgaattctctaagcttggctacatt
ggtaaactctatcattctcatgatctcccacgtttggcccattttttattaatgttttat
caagaaatgccttgtgattggctattgactcatttccgtggtctgttggctcagaaaaat
gtgatccgttttaaaccatctctctttcagcacatgggctattattcatcatacaaaggg
acggagaataagctgaaggatgatgattttgaagaggagtcatttgacattcctgataac
ccccctgcaagtctgtacaccaacatgaatgtgtttgaaaattatgaagcaagcaaggct
tacagtagtgttgatgagtacttttgggggaaaccaccttcaacaggagatgtttttgtg
attgtatttgaaaatccaattataataaaaaaaattaaagtaaatactggaacagaagat
cggcaaaatgatattttgcatcatggagccctagatgttggggaaaacgttatgcctagc
aaacaaaggagacaatgttctacttacttaagactaggagaattcaaaaatggaaacttt
gaaatgtcaggtgtaaatcaaaaaattccatttgatatacattgtatgaggatatatgtc
accaaaacacaaaaggaatggctaattattaggagtattagcatttggacttcttag

DBGET integrated database retrieval system