KEGG   Homo sapiens (human): 25902Help
Entry
25902             CDS       T01001                                 

Gene name
MTHFD1L, FTHFSDC1, MTC1THFS, dJ292B18.2
Definition
methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like (EC:6.3.4.3)
Orthology
K13402  
monofunctional C1-tetrahydrofolate synthase, mitochondrial [EC:6.3.4.3]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Metabolic pathways
Module
C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    25902 (MTHFD1L)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     25902 (MTHFD1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q25.1
AA seq 979 aa AA seqDB search
MGTRLPLVLRQLRRPPQPPGPPRRLRVPCRASSGGGGGGGGGREGLLGQRRPQDGQARSS
CSPGGRTPAARDSIVREVIQNSKEVLSLLQEKNPAFKPVLAIIQAGDDNLMQEINQNLAE
EAGLNITHICLPPDSSEAEIIDEILKINEDTRVHGLALQISENLFSNKVLNALKPEKDVD
GVTDINLGKLVRGDAHECFVSPVAKAVIELLEKSVGVNLDGKKILVVGAHGSLEAALQCL
FQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGK
VGCGSPRIHFGGLIEEDDVILLAAALRIQNMVSSGRRWLREQQHRRWRLHCLKLQPLSPV
PSDIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVRLSVLERLKDQADGKYVLVAG
ITPTPLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPME
EFNLHLTGDIHAITAANNLLAAAIDTRILHENTQTDKALYNRLVPLVNGVREFSEIQLAR
LKKLGINKTDPSTLTEEEVSKFARLDIDPSTITWQRVLDTNDRFLRKITIGQGNTEKGHY
RQAQFDIAVASEIMAVLALTDSLADMKARLGRMVVASDKSGQPVTADDLGVTGALTVLMK
DAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIG
MEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCC
NLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSV
DLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQG
FGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTR
PCFYDIDLDTETEQVKGLF
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgcgtctgccgctcgtcctgcgccagctccgccgcccgccccagcccccgggc
cctccgcgccgcctccgtgtgccctgtcgcgctagcagcggcggcggcggaggcggcggc
ggtggccgggagggcctgcttggacagcggcggccgcaggatggccaggcccggagcagc
tgcagccccggcggccgaacgcccgcggcgcgggactccatcgtcagagaagtcattcag
aattcaaaagaagttctaagtttattgcaagaaaaaaaccctgccttcaagccggttctt
gcaattatccaggcaggtgacgacaacttgatgcaggaaatcaaccagaatttggctgag
gaggctggtctgaacatcactcacatttgcctccctccagatagcagtgaagccgagatt
atagatgaaatcttaaagatcaatgaagataccagagtacatggccttgcccttcagatc
tctgagaacttgtttagcaacaaagtcctcaatgccttgaaaccagaaaaagatgtggat
ggagtaacagacataaacctggggaagctggtgcgaggggatgcccatgaatgttttgtt
tcacctgttgccaaagctgtaattgaacttcttgaaaaatcagtaggtgtcaacctagat
ggaaagaagattttggtagtgggggcccatgggtctttggaagctgctctacaatgcctg
ttccagagaaaagggtccatgacaatgagcatccagtggaaaacacgccagcttcaaagc
aagcttcacgaggctgacattgtggtcctaggctcacctaagccagaagagattcccctt
acttggatacaaccaggaactactgttctcaactgctcccatgacttcctgtcagggaag
gttgggtgtggctctccaagaatacattttggtggactcattgaggaagatgatgtgatt
ctccttgctgcagctctgcgaattcagaacatggtcagtagtggaaggagatggcttcgt
gaacagcagcacaggcggtggagacttcactgcttgaaacttcagcctctctcccctgtg
ccaagtgacattgagatttcaagaggacaaactccaaaagctgtggatgtccttgccaag
gagattggattgcttgcagatgaaattgaaatctatggcaaaagcaaagccaaagtacgt
ttgtccgtgctagaaaggttaaaggatcaagcagatggaaaatacgtcttagttgctggg
atcacacccacccctcttggagaagggaagagcacagtcaccatcgggcttgtgcaggct
ctgaccgcacacctgaatgtcaactcctttgcctgcttgaggcagccttcccaaggaccg
acgtttggagtgaaaggaggagccgcgggtggtggatatgcccaggtcatccccatggag
gagttcaaccttcacttgactggagacatccacgccatcaccgctgccaataacttgctg
gctgccgccatcgacacgaggattcttcatgaaaacacgcaaacagataaggctctgtat
aatcggctggttcctttagtgaatggtgtcagagaattttcagaaattcagcttgctcgg
ctaaaaaaactgggaataaataagactgatccgagcacactgacagaagaggaagtgagt
aaatttgcccgtctcgacatcgacccatctaccatcacgtggcagagagtattggataca
aatgaccgatttctacgaaaaataaccatcgggcagggaaacacagagaagggccattac
cggcaggcgcagtttgacatcgcagtggccagcgagatcatggcggtgctggccctgacg
gacagcctcgcagacatgaaggcacggctgggaaggatggtggtggccagtgacaaaagc
gggcagcctgtgacagcagatgatttgggggtgacaggtgctttgacagttttgatgaaa
gatgcaataaaaccaaacctgatgcagaccctggaagggacacctgtgttcgtgcatgcg
ggcccttttgctaacattgctcacggcaactcttcagtgttggctgataaaattgccctg
aaactggttggtgaagaaggatttgtagtgaccgaagctggctttggtgctgacatcgga
atggagaaattcttcaacatcaagtgccgagcttccggcttggtgcccaacgtggttgtg
ttagtggcaacggtgcgagctctgaagatgcatggaggcgggccaagtgtaacggctggt
gttcctcttaagaaagaatatacagaggagaacatccagctggtggcagacggctgctgt
aacctccagaagcaaattcagatcactcagctctttggggttcccgttgtggtggctctg
aatgtcttcaagaccgacacccgcgctgagattgacttggtgtgtgagcttgcaaagcgg
gctggtgcctttgatgcagtcccctgctatcactggtccgttggtggaaaaggatcggtg
gacttggctcgggctgtgagagaggctgcgagtaaaagaagccgattccagttcctgtat
gatgttcaggttccaattgtggacaagataaggaccattgctcaggctgtctatggagcc
aaagatattgaactctctcctgaggcacaagccaaaatagatcgttacactcaacagggt
tttggaaatttgcccatctgcatggcaaagacccacctttctctatctcaccaacctgac
aaaaaaggtgtgccaagggacttcatcttacctatcagtgacgtccgggccagcataggc
gctgggttcatttaccctttggtcggaacgatgagcaccatgccaggactgcccacccgg
ccctgcttttatgacatagatcttgataccgaaacagaacaagttaaaggcttgttctaa

DBGET integrated database retrieval system