KEGG   Homo sapiens (human): 2595Help
Entry
2595              CDS       T01001                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00500  Starch and sucrose metabolism
hsa01100  Metabolic pathways
Drug target
Acarbose: D00216
Emiglitate: D09779
Miglitol: D00625
Voglibose: D01665
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    2595 (GANC)
   00500 Starch and sucrose metabolism
    2595 (GANC)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     2595 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 2595
NCBI-ProteinID: NP_937784
OMIM: 104180
HGNC: 4139
Ensembl: ENSG00000214013
Vega: OTTHUMG00000130487
Pharos: Q8TET4(Tchem)
UniProt: Q8TET4
Position
15q15.1
AA seq 914 aa AA seqDB search
MEAAVKEEISLEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEET
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSFADQRGHYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEK
LSLNIATDWEVRII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcagtgaaagaggaaataagtcttgaagatgaagctgtagataaaaacatt
ttcagagactgtaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattattggattcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttcctctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccagatttgaagttccggat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctctggggacacaggcagt
ctgatattggcagatggaaaaggagacctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggagaca
tcagtggacacctctcaggaaaatcaagaagatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggcccttcttctattggtttggatttctccttgcat
ggatttgagcatctttatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggtattttctggctgaatgcctcggaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgcact
catgtgcactggatgtcagagagtggcatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaacagattcccaaaccccaagagg
atgcaagagctgctcaggagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggggtgtgttggccaggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcctttggaatgacatgaatgagccttctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagagctc
cacaacatctacggtttttatcatcaaatggctactgcagaaggactgataaaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgccgtgtggacaggcgacaacacagcagaatggagcaacttgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgcggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggctggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgagagccctggctctttggggag
gaacacacccgactcatccgagaagccatcagagagcgctatggcctcctgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgtcatgaggcctctgtgggta
gagttccctgatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttattggttcatccagtcacagaaccaaaagccaccacagttgatgtgtttcttccagga
tcaaatgaggtctggtatgactataagacatttgctcattgggaaggagggtgtactgta
aagatcccagtagccttggacactattccagtgtttcagcgaggtggaagtgtgatacca
ataaagacaactgtaggaaaatccacaggctggatgactgaatcctcctatggactccgg
gttgctctaagcactaagggttcttcagtgggtgagttatatcttgatgatggccattca
ttccaatacctccaccagaagcaatttttgcacaggaagttttcattctgttccagtgtt
ctgatcaatagttttgctgaccagaggggtcattatcccagcaagtgtgtggtggagaag
atcttggtcttaggcttcaggaaggagccatcttctgtgactacccactcatctgatggt
aaagatcagcctgtggcttttacgtattgtgccaaaacatccatcctgagcctggagaag
ctctcactcaacattgccactgactgggaggtccgcatcatatga

DBGET integrated database retrieval system