KEGG   Homo sapiens (human): 2595Help
Entry
2595              CDS       T01001                                 

Gene name
GANC
Definition
glucosidase, alpha; neutral C (EC:3.2.1.20)
Orthology
K12317  
neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Drug target
Acarbose: 
Miglitol: 
Voglibose: 
Other: 
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q15.2
AA seq 914 aa AA seqDB search
MEAAVKEEISLEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEET
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPKR
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATTVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIP
IKTTVGKSTGWMTESSYGLRVALSTKGSSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSFADQRGHYPSKCVVEKILVLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEK
LSLNIATDWEVRII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcagtgaaagaggaaataagtcttgaagatgaagctgtagataaaaacatt
ttcagagactgtaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattattggattcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttcctctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccagatttgaagttccggat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctctggggacacaggcagt
ctgatattggcagatggaaaaggagacctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggagaca
tcagtggacacctctcaggaaaatcaagaagatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggcccttcttctattggtttggatttctccttgcat
ggatttgagcatctttatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatggagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggtattttctggctgaatgcctcggaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgcact
catgtgcactggatgtcagagagtggcatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggataccaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaacagattcccaaaccccaagagg
atgcaagagctgctcaggagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggggtgtgttggccaggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcctttggaatgacatgaatgagccttctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagagctc
cacaacatctacggtttttatcatcaaatggctactgcagaaggactgataaaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgccgtgtggacaggcgacaacacagcagaatggagcaacttgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgcggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggctggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgagagccctggctctttggggag
gaacacacccgactcatccgagaagccatcagagagcgctatggcctcctgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgtcatgaggcctctgtgggta
gagttccctgatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttattggttcatccagtcacagaaccaaaagccaccacagttgatgtgtttcttccagga
tcaaatgaggtctggtatgactataagacatttgctcattgggaaggagggtgtactgta
aagatcccagtagccttggacactattccagtgtttcagcgaggtggaagtgtgatacca
ataaagacaactgtaggaaaatccacaggctggatgactgaatcctcctatggactccgg
gttgctctaagcactaagggttcttcagtgggtgagttatatcttgatgatggccattca
ttccaatacctccaccagaagcaatttttgcacaggaagttttcattctgttccagtgtt
ctgatcaatagttttgctgaccagaggggtcattatcccagcaagtgtgtggtggagaag
atcttggtcttaggcttcaggaaggagccatcttctgtgactacccactcatctgatggt
aaagatcagcctgtggcttttacgtattgtgccaaaacatccatcctgagcctggagaag
ctctcactcaacattgccactgactgggaggtccgcatcatatga

DBGET integrated database retrieval system