KEGG   Homo sapiens (human): 25978Help
Entry
25978             CDS       T01001                                 

Gene name
CHMP2B, ALS17, CHMP2.5, DMT1, VPS2-2, VPS2B
Definition
charged multivesicular body protein 2B
Orthology
K12192  
charged multivesicular body protein 2B
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-III complex
Disease
H00078  
Frontotemporal lobar degeneration (FTLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    25978 (CHMP2B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25978 (CHMP2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p11.2
AA seq 172 aa AA seqDB search
MELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGA
MSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQD
IVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggaattagaaattaagaaaatggccaagattggtaataaggaagcttgcaaagtttta
gccaaacaacttgtgcatctacggaaacagaagacgagaacttttgctgtaagttcaaaa
gttacttctatgtctacacaaacaaaagtgatgaattcccaaatgaagatggctggagca
atgtctactacagcaaaaacaatgcaggcagttaacaagaagatggatccacaaaagaca
ttacaaacaatgcagaatttccagaaggaaaacatgaaaatggaaatgactgaagaaatg
atcaatgatacacttgatgacatctttgacggttctgatgacgaagaagaaagccaggat
attgtgaatcaagttcttgatgaaattggaattgaaatttctggaaagatggccaaagct
ccatcagctgctcgaagcttaccatctgcctctacttcaaaggctacaatctcagatgaa
gagattgaacggcaactcaaggctttaggagtagattag

DBGET integrated database retrieval system