KEGG   Homo sapiens (human): 26Help
Entry
26                CDS       T01001                                 

Gene name
AOC1, ABP, ABP1, DAO, DAO1, KAO
Definition
amine oxidase, copper containing 1 (EC:1.4.3.22)
Orthology
K11182  
diamine oxidase [EC:1.4.3.22]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    26 (AOC1)
   00340 Histidine metabolism
    26 (AOC1)
   00380 Tryptophan metabolism
    26 (AOC1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.22  diamine oxidase
     26 (AOC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36.1
AA seq 751 aa AA seqDB search
MPALGWAVAAILMLQTAMAEPSPGTLPRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSS
TTTMAKNTVFLIEMLLPKKYHVLRFLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLP
GPCYMRALSPRPGYQSSWASRPISTAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR
CLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHPTGLELLVDHGSTDAGHWAVEQVWYNG
KFYGSPEELARKYADGEVDVVVLEDPLPGGKGHDSTEEPPLFSSHKPRGDFPSPIHVSGP
RLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGERIAYEVSVQEAVALYG
GHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDPVHYPRALCLFE
MPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGVMEAKMH
ATGYVHATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENIT
NPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRTYRLQIHSM
ADQVLPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWHPPVVFEQFLHNNENI
ENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDTVIVWPRD
NGPNYVQRWIPEDRDCSMPPPFSYNGTYRPV
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atgccggccctgggctgggccgtggctgccatcctgatgctgcagacggccatggcggag
ccctccccggggactctgcccaggaaggcaggggtgttttcagacctaagcaaccaagag
ctgaaggcagtgcacagcttcctctggtccaagaaggagctgaggctgcagccctccagt
accaccaccatggccaagaacaccgtgtttctcatcgagatgctgctgcccaagaagtac
catgtgctgaggtttctggataaaggtgaaaggcatcctgtgcgggaagcccgtgccgtc
atcttctttggtgaccaggagcatcccaatgtcaccgagtttgctgtggggcccctgcca
gggccctgctacatgcgagcactgtcccccaggcctgggtaccagtcctcctgggcatcg
aggcccatctccacagcagagtatgccctcctctaccacaccctgcaggaagccaccaag
cccctgcatcagttcttcctcaataccacaggcttctcattccaagactgccatgacaga
tgcctggccttcaccgatgtggccccccggggtgtggcttctggccagcgccgcagttgg
cttatcatacagcgctatgtagaaggctactttctgcaccccactgggctggagctcctc
gtggatcatgggagcacagatgctgggcactgggccgtggagcaggtgtggtacaacggg
aagttctatgggagcccagaggaactggctcggaagtatgcagatggagaggtggacgtg
gtggtcctggaggacccgctgcctgggggcaaggggcatgacagcacagaggagccgccc
ctcttctcctcccacaagccccgcggggacttccccagccccatccatgtgagcggcccc
cgcttggtccagccccacggccctcgcttcaggctggagggcaacgctgtgctctacggc
ggctggagctttgccttccggctgcgctcctcctccgggctgcaggtcctgaacgtgcac
ttcggcggagagcgcattgcctatgaggtcagcgtgcaagaggcagtggcgctgtatgga
ggacacacacctgcaggcatgcagaccaagtacctcgatgtcggctggggcctgggcagc
gtcactcatgagttagcccccggcatcgactgcccggagaccgccaccttcctggacact
ttccactactatgatgccgatgacccggtccattatccccgagccctctgcctctttgaa
atgcccacaggggtgccccttcggcggcactttaattccaactttaaaggtggcttcaac
ttctatgcggggctgaagggccaggtgctggtgctgcggacaacttcaactgtctacaat
tatgattacatttgggactttatcttctaccccaacggggtgatggaggccaagatgcat
gccactggctacgtccacgccaccttctacacccccgaggggctgcgccacggcactcgc
ctgcacacccacctgattggcaacatacacactcacttggtgcactaccgcgtagacctg
gatgtggcaggcaccaagaacagcttccagacactgcagatgaagctagaaaacatcacc
aacccctggagcccaagacaccgcgtggtccagccaactctggagcagacgcagtactcc
tgggagcgccaggcggccttccgcttcaaaaggaagctgcctaagtacctgctctttacc
agcccccaggagaacccctggggccacaagcgcacgtaccgcctgcagatccactccatg
gccgaccaggtgctgcccccaggctggcaggaggagcaggccatcacctgggcaaggtac
cccctggcagtgaccaagtaccgggagtcggagctgtgcagcagcagcatctaccaccag
aacgacccctggcacccgcccgtggtctttgagcagtttcttcacaacaacgagaacatt
gaaaatgaggacctggtggcctgggtgacggtgggcttcctgcacatcccccactcagag
gacattcccaacacagccacacctgggaactccgtgggcttcctgctccggccattcaac
ttcttcccagaggacccctccctggcatccagagacactgtgatcgtgtggcctcgggac
aacggccccaactacgtccagcgctggatccctgaggacagggactgctcgatgcctccc
ccttttagctacaatgggacctatagacctgtgtga

DBGET integrated database retrieval system