KEGG   Homo sapiens (human): 262Help
Entry
262               CDS       T01001                                 

Gene name
AMD1, ADOMETDC, AMD, SAMDC
Definition
(RefSeq) adenosylmethionine decarboxylase 1
  KO
K01611  
S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Methionine salvage pathway
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    262 (AMD1)
   00330 Arginine and proline metabolism
    262 (AMD1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     262 (AMD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P17707(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 334 aa AA seqDB search
MEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQ
EAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKP
SHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEIL
MSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYW
TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQ
KIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcacattttttcgaagggaccgagaagctgctggaggtttggttctcccgg
cagcagcccgacgcaaaccaaggatctggggatcttcgcactatcccaagatctgagtgg
gacatacttttgaaggatgtgcaatgttcaatcataagtgtgacaaaaactgacaagcag
gaagcttatgtactcagtgagagtagcatgtttgtctccaagagacgtttcattttgaag
acatgtggtaccaccctcttgctgaaagcactggttcccctgttgaagcttgctagggat
tacagtgggtttgactcaattcaaagcttcttttattctcgtaagaatttcatgaagcct
tctcaccaagggtacccacaccggaatttccaggaagaaatagagtttcttaatgcaatt
ttcccaaatggagcagcatattgtatgggacgtatgaattctgactgttggtacttatat
actctggatttcccagagagtcgggtaatcagtcagccagatcaaaccttggaaattctg
atgagtgagcttgacccagcagttatggaccagttctacatgaaagatggtgttactgca
aaggatgtcactcgtgagagtggaattcgtgacctgataccaggttctgtcattgatgcc
acaatgttcaatccttgtgggtattcgatgaatggaatgaaatcggatggaacttattgg
actattcacatcactccagaaccagaattttcttatgttagctttgaaacaaacttaagt
cagacctcctatgatgacctgatcaggaaagttgtagaagtcttcaagccaggaaaattt
gtgaccaccttgtttgttaatcagagttctaaatgtcgcacagtgcttgcttcgccccag
aagattgaaggttttaagcgtcttgattgccagagtgctatgttcaatgattacaatttt
gtttttaccagttttgctaagaagcagcaacaacagcagagttga

DBGET integrated database retrieval system