KEGG   Homo sapiens (human): 26224Help
Entry
26224             CDS       T01001                                 

Gene name
FBXL3, FBL3, FBL3A, FBXL3A
Definition
F-box and leucine-rich repeat protein 3
Orthology
K10269  
F-box and leucine-rich repeat protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    26224 (FBXL3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     26224 (FBXL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q22
AA seq 428 aa AA seqDB search
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaggaggaagagatagtgaccgtaattcatcagaagaaggaactgcagagaaa
tccaagaaactgaggactacaaatgagcattctcagacttgtgattggggtaatctcctt
caggacattattctccaagtatttaaatatttgcctcttcttgaccgggctcatgcttca
caagtttgccgcaactggaaccaggtatttcacatgcctgacttgtggagatgttttgaa
tttgaactgaatcagccagctacatcttatttgaaagctacccatccagagctgatcaaa
cagattattaaaagacattcaaaccatctacaatatgtcagcttcaaggtggacagcagc
aaggaatcagctgaagcagcttgtgatatactatcgcaacttgtgaattgctctttaaaa
acacttggacttatttcaactgctcgaccaagctttatggatttaccaaagtctcacttt
atctctgcactgacagttgtgttcgtaaactccaaatccctgtcttcgcttaagatagat
gatactccagtagatgatccatctctcaaagtactagtggccaacaatagtgatacactc
aagctgttgaaaatgagcagctgtcctcatgtctctccagcaggtatcctttgtgtggct
gatcagtgtcacggcttaagagaactagccctgaactaccacttattgagtgatgagttg
ttacttgcattgtcttctgaaaaacatgttcgattagaacatttgcgcattgatgtagtc
agtgagaatcctggacagacacacttccatactattcagaagagtagctgggatgctttc
atcagacattcacccaaagtgaacttagtgatgtatttttttttatatgaagaagaattt
gaccccttctttcgctatgaaatacctgccacccatctgtactttgggagatcagtaagc
aaagatgtgcttggccgtgtgggaatgacatgccctagactggttgaactagtagtgtgt
gcaaatggattacggccacttgatgaagagttaattcgcattgcagaacgttgcaaaaat
ttgtcagctattggactaggggaatgtgaagtctcatgtagtgcctttgttgagtttgtg
aagatgtgtggtggccgcctatctcaattatccattatggaagaagtactaattcctgac
caaaagtatagtttggagcagattcactgggaagtgtccaagcatcttggtagggtgtgg
tttcccgacatgatgcccacttggtaa

DBGET integrated database retrieval system