KEGG   Homo sapiens (human): 26246Help
Entry
26246             CDS       T01001                                 

Gene name
OR2L2, HSHTPCRH07, HTPCRH07, OR1-48, OR2L12, OR2L4P
Definition
(RefSeq) olfactory receptor family 2 subfamily L member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    26246 (OR2L2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    26246 (OR2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 26246
NCBI-ProteinID: NP_001004686
HGNC: 8266
Ensembl: ENSG00000203663
Vega: OTTHUMG00000040214
Pharos: Q8NH16(Tdark)
UniProt: Q8NH16 A0A126GW34
Position
1q44
AA seq 312 aa AA seqDB search
MENYNQTSTDFILLGLFPQSRIGLFVFTLIFLIFLMALIGNLSMILLIFLDIHLHTPMYF
LLSQLSLIDLNYISTIVPKMVYDFLYGNKSISFTGCGIQSFFFLTLAVAEGLLLTSMAYD
RYVAICFPLHYPIRISKRVCVMMITGSWMISSINSCAHTVYALCIPYCKSRAINHFFCDV
PAMLTLACTDTWVYESTVFLSSTIFLVLPFTGIACSYGRVLLAVYRMHSAEGRKKAYSTC
STHLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLRNKEVMGAL
TQVIQKIFSVKM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattacaatcaaacatcaactgatttcatcttattggggctgttcccacaatca
agaattggccttttcgtattcaccctcatttttctcattttcctaatggctctaattgga
aatctatccatgattcttctcatctttttggacatccatctccacacacctatgtatttc
ctacttagtcagctctccctcattgacctaaattacatctccaccattgttccaaagatg
gtttatgattttctgtatggaaacaagtctatctccttcactggatgtgggattcagagt
ttcttcttcttgactttagcagttgcagaagggctgctcctgacatcaatggcctatgat
cgttatgtggccatttgctttcctctccactatcccatccgtataagcaaaagagtgtgt
gtgatgatgataacaggatcttggatgataagctctatcaactcttgtgctcacacagta
tatgcactctgtatcccatattgcaagtccagagccatcaatcattttttctgtgatgtt
ccagctatgttgacgctagcctgcacagacacttgggtctatgagagcacagtgtttttg
agcagcaccatctttcttgtgcttcctttcactggtattgcatgttcctatggccgggtt
ctccttgctgtctaccgcatgcactctgcagaagggaggaagaaggcctattcaacctgt
agcacccacctcactgtagtgtccttctactatgcaccctttgcttatacctatgtacgt
ccaagatccctgcgatctccaacagaggacaagattctggctgttttctacaccatcctc
accccaatgctcaaccccatcatctacagcctgagaaacaaggaggtgatgggggccctg
acacaagtgattcagaaaatcttctcagtgaaaatgtag

DBGET integrated database retrieval system