KEGG   Homo sapiens (human): 26271Help
Entry
26271             CDS       T01001                                 

Gene name
FBXO5, EMI1, FBX5, Fbxo31
Definition
(RefSeq) F-box protein 5
  KO
K10292  
F-box protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    26271 (FBXO5)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26271 (FBXO5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    26271 (FBXO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.2
AA seq 447 aa AA seqDB search
MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGL
KLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKEN
QHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQI
QSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMG
LECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQ
RVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHN
EFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS
DGKLLKASCKIGPLPGTKKSKKNLRRL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcgcccctgcagctgcgccctacggccaccccgctgctcctgcagcgccagc
cccagcgcagtgacagccgccgggcgccctcgaccctcggatagttgtaaagaagaaagt
tctaccctttctgtcaaaatgaagtgtgattttaattgtaaccatgttcattccggactt
aaactggtaaaacctgatgacattggaagactagtttcctacacccctgcatatttggaa
ggttcctgtaaagactgcattaaagactatgaaaggctgtcatgtattgggtcaccgatt
gtgagccctaggattgtacaacttgaaactgaaagcaagcgcttgcataacaaggaaaat
caacatgtgcaacagacacttaatagtacaaatgaaatagaagcactagagaccagtaga
ctttatgaagacagtggctattcctcattttctctacaaagtggcctcagtgaacatgaa
gaaggtagcctcctggaggagaatttcggtgacagtctacaatcctgcctgctacaaata
caaagcccagaccaatatcccaacaaaaacttgctgccagttcttcattttgaaaaagtg
gtttgttcaacattaaaaaagaatgcaaaacgaaatcctaaagtagatcgggagatgctg
aaggaaattatagccagaggaaattttagactgcagaatataattggcagaaaaatgggc
ctagaatgtgtagatattctcagcgaactctttcgaaggggactcagacatgtcttagca
actattttagcacaactcagtgacatggacttaatcaatgtgtctaaagtgagcacaact
tggaagaagatcctagaagatgataagggggcattccagttgtacagtaaagcaatacaa
agagttaccgaaaacaacaataaattttcacctcatgcttcaaccagagaatatgttatg
ttcagaaccccactggcttctgttcagaaatcagcagcccagacttctctcaaaaaagat
gctcaaaccaagttatccaatcaaggtgatcagaaaggttctacttatagtcgacacaat
gaattctctgaggttgccaagacattgaaaaagaacgaaagcctcaaagcctgtattcgc
tgtaattcacctgcaaaatatgattgctatttacaacgggcaacctgcaaacgagaaggc
tgtggatttgattattgtacgaagtgtctctgtaattatcatactactaaagactgttca
gatggcaagctcctcaaagccagttgtaaaataggtcccctgcctggtacaaagaaaagc
aaaaagaatttacgaagattgtga

DBGET integrated database retrieval system