KEGG   Homo sapiens (human): 26271Help
Entry
26271             CDS       T01001                                 

Gene name
FBXO5, EMI1, FBX5, Fbxo31
Definition
F-box protein 5
Orthology
K10292  
F-box protein 5
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Class
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q25.2
AA seq 401 aa AA seqDB search
MKCDFNCNHVHSGLKLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIV
QLETESKRLHNKENQHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLE
ENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIAR
GNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILE
DDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLS
NQGDQKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYC
TKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRRL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtgattttaattgtaaccatgttcattccggacttaaactggtaaaacctgat
gacattggaagactagtttcctacacccctgcatatttggaaggttcctgtaaagactgc
attaaagactatgaaaggctgtcatgtattgggtcaccgattgtgagccctaggattgta
caacttgaaactgaaagcaagcgcttgcataacaaggaaaatcaacatgtgcaacagaca
cttaatagtacaaatgaaatagaagcactagagaccagtagactttatgaagacagtggc
tattcctcattttctctacaaagtggcctcagtgaacatgaagaaggtagcctcctggag
gagaatttcggtgacagtctacaatcctgcctgctacaaatacaaagcccagaccaatat
cccaacaaaaacttgctgccagttcttcattttgaaaaagtggtttgttcaacattaaaa
aagaatgcaaaacgaaatcctaaagtagatcgggagatgctgaaggaaattatagccaga
ggaaattttagactgcagaatataattggcagaaaaatgggcctagaatgtgtagatatt
ctcagcgaactctttcgaaggggactcagacatgtcttagcaactattttagcacaactc
agtgacatggacttaatcaatgtgtctaaagtgagcacaacttggaagaagatcctagaa
gatgataagggggcattccagttgtacagtaaagcaatacaaagagttaccgaaaacaac
aataaattttcacctcatgcttcaaccagagaatatgttatgttcagaaccccactggct
tctgttcagaaatcagcagcccagacttctctcaaaaaagatgctcaaaccaagttatcc
aatcaaggtgatcagaaaggttctacttatagtcgacacaatgaattctctgaggttgcc
aagacattgaaaaagaacgaaagcctcaaagcctgtattcgctgtaattcacctgcaaaa
tatgattgctatttacaacgggcaacctgcaaacgagaaggctgtggatttgattattgt
acgaagtgtctctgtaattatcatactactaaagactgttcagatggcaagctcctcaaa
gccagttgtaaaataggtcccctgcctggtacaaagaaaagcaaaaagaatttacgaaga
ttgtga

DBGET integrated database retrieval system