KEGG   Homo sapiens (human): 26277Help
Entry
26277             CDS       T01001                                 

Gene name
TINF2, DKCA3, TIN2
Definition
TERF1 (TRF1)-interacting nuclear factor 2
Orthology
K11112  
TERF1-interacting nuclear factor 2
Organism
hsa  Homo sapiens (human)
Module
Shelterin complex
Disease
H00921  
Revesz syndrome
Brite
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomere proteins
    Shelterin complex
     26277 (TINF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q12
AA seq 451 aa AA seqDB search
MATPLVAGPAALRFAAAASWQVVRGRCVEHFPRVLEFLRSLRAVAPGLVRYRHHERLCMG
LKAKVVVELILQGRPWAQVLKALNHHFPESGPIVRDPKATKQDLRKILEAQETFYQQVKQ
LSEAPVDLASKLQELEQEYGEPFLAAMEKLLFEYLCQLEKALPTPQAQQLQDVLSWMQPG
VSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHL
PQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVI
SKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCY
MDPLRLSLLPPRARKPVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDT
LIPTLCEYLPPSGHGAIPVSSCDCRDSSRPL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggctacgcccctggtggcgggtcccgcagctctacgcttcgccgccgcggctagctgg
caggttgtgcgcggacgctgcgtggaacattttccgcgagtactggagtttctgcgatct
ctgcgcgctgttgcccctggcttggttcgctaccggcaccacgaacgcctttgtatgggc
ctaaaggccaaggtggtggtggagctgatcctgcagggccggccttgggcccaagtcctg
aaagccctgaatcaccactttccagaatctggacctatagtgcgggatcccaaggctaca
aagcaggatctgaggaagattttggaggcacaggaaactttttaccagcaggtgaagcag
ctgtcagaggctcctgtggatttggcctcgaagctgcaggaacttgaacaagagtatggg
gaaccctttctggctgccatggaaaagctgctttttgagtacttgtgtcagctggagaaa
gcactgcctacaccgcaggcacagcagcttcaggatgtgctgagttggatgcagcctgga
gtctctatcacctcttctcttgcctggagacaatatggtgtggacatggggtggctgctt
ccagagtgctctgttactgactcagtgaacctggctgagcccatggaacagaatcctcct
cagcaacaaagactagcactccacaatcccctgccaaaagccaagcctggcacacatctt
cctcagggaccatcttcaaggacgcacccagaacctctagctggccgacacttcaatctg
gcccctctaggccgacgaagagttcagtcccaatgggcctccactaggggaggccataag
gagcgccccacagtcatgctgtttccctttaggaatctcggctcaccaacccaggtcata
tctaagcctgagagcaaggaagaacatgcgatatacacagcagacctagccatgggcaca
agagcagcctccactgggaagtctaagagtccatgccagaccctggggggaagggctctg
aaggagaacccagttgacttgcctgccacagagcaaaaggagaattgcttggattgctac
atggaccccctgagactatcattattacctcctagggccaggaagccagtgtgtcctccg
tctctgtgcagctccgtcattaccataggggacttggttttagactctgatgaggaagaa
aatggccagggggaaggaaaggaatctctggaaaactatcagaagacaaagtttgacacc
ttgatacccactctctgtgaatacctacccccttctggccacggtgccatacctgtttct
tcctgtgactgtagagacagttctagacctttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system