KEGG   Homo sapiens (human): 26279Help
Entry
26279             CDS       T01001                                 

Gene name
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Definition
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Drug target
Varespladib (DG01394): D06283 D08107 D08221
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    26279 (PLA2G2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N DUF5460
Motif
Other DBs
NCBI-GeneID: 26279
NCBI-ProteinID: NP_036532
OMIM: 605630
HGNC: 9033
Ensembl: ENSG00000117215
Vega: OTTHUMG00000002701
Pharos: Q9UNK4(Tchem)
UniProt: Q9UNK4
Position
1p36.12
AA seq 145 aa AA seqDB search
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLK
RNLDTYQKRLRFYWRPHCRGQTPGC
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactggtgctgccagacccatgactgctgctatgaccacctgaagacccaggggtgcagc
atctacaaggactattacagatacaacttttcccaggggaacatccactgctctgacaag
ggaagctggtgtgagcagcagctgtgtgcctgtgacaaggaggtggccttctgcctgaag
cgcaacctggacacctaccagaagcgactgcgtttctactggcggccccactgccggggg
cagacccctgggtgctag

DBGET integrated database retrieval system