KEGG   Homo sapiens (human): 26279Help
Entry
26279             CDS       T01001                                 

Gene name
PLA2G2D, PLA2IID, SPLASH, sPLA2-IID, sPLA2S
Definition
phospholipase A2, group IID (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Vascular smooth muscle contraction
Pancreatic secretion
Fat digestion and absorption
Drug target
Orlistat: 
Meclofenamic acid: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    26279 (PLA2G2D)
   00565 Ether lipid metabolism
    26279 (PLA2G2D)
   00590 Arachidonic acid metabolism
    26279 (PLA2G2D)
   00591 Linoleic acid metabolism
    26279 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    26279 (PLA2G2D)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    26279 (PLA2G2D)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    26279 (PLA2G2D)
  Digestive system
   04972 Pancreatic secretion
    26279 (PLA2G2D)
   04975 Fat digestion and absorption
    26279 (PLA2G2D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     26279 (PLA2G2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p36.12
AA seq 62 aa AA seqDB search
MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDAT
DC
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgcactgctgtgtgggctggtggtgatggctggtgtgattccaatccagggc
gggatcctgaacctgaacaagatggtcaagcaagtgactgggaaaatgcccatcctctcc
tactggccctacggctgtcactgcggactaggtggcagaggccaacccaaagatgccacg
gactgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system