KEGG   Homo sapiens (human): 2693Help
Entry
2693              CDS       T01001                                 

Gene name
GHSR, GHDP
Definition
(RefSeq) growth hormone secretagogue receptor
  KO
K04284  
growth hormone secretagogue receptor
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Anamorelin hydrochloride: 
Capromorelin tartrate: 
Macimorelin (DG01879): 
Pralmorelin dihydrochloride: 
Relamorelin: 
Rismorelin porcine: 
Ulimorelin (DG01338): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    2693 (GHSR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2693 (GHSR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Ghrelin
    2693 (GHSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.31
AA seq 366 aa AA seqDB search
MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgcgacgcccagcgaagagccggggttcaacctcacactggccgacctggac
tgggatgcttcccccggcaacgactcgctgggcgacgagctgctgcagctcttccccgcg
ccgctgctggcgggcgtcacagccacctgcgtggcactcttcgtggtgggcatcgctggc
aacctgctcaccatgctggtggtgtcgcgcttccgcgagctgcgcaccaccaccaacctc
tacctgtccagcatggccttctccgatctgctcatcttcctctgcatgcccctggacctc
gttcgcctctggcagtaccggccctggaacttcggcgacctcctctgcaaactcttccaa
ttcgtcagtgagagctgcacctacgccacggtgctcaccatcacagcgctgagcgtcgag
cgctacttcgccatctgcttcccactccgggccaaggtggtggtcaccaaggggcgggtg
aagctggtcatcttcgtcatctgggccgtggccttctgcagcgccgggcccatcttcgtg
ctagtcggggtggagcacgagaacggcaccgacccttgggacaccaacgagtgccgcccc
accgagtttgcggtgcgctctggactgctcacggtcatggtgtgggtgtccagcatcttc
ttcttccttcctgtcttctgtctcacggtcctctacagtctcatcggcaggaagctgtgg
cggaggaggcgcggcgatgctgtcgtgggtgcctcgctcagggaccagaaccacaagcaa
accgtgaaaatgctggctgtagtggtgtttgccttcatcctctgctggctccccttccac
gtagggcgatatttattttccaaatcctttgagcctggctccttggagattgctcagatc
agccagtactgcaacctcgtgtcctttgtcctcttctacctcagtgctgccatcaacccc
attctgtacaacatcatgtccaagaagtaccgggtggcagtgttcagacttctgggattc
gaacccttctcccagagaaagctctccactctgaaagatgaaagttctcgggcctggaca
gaatctagtattaatacatga

DBGET integrated database retrieval system