KEGG   Homo sapiens (human): 27012Help
Entry
27012             CDS       T01001                                 

Gene name
KCNV1, HNKA, KCNB3, KV2.3, KV8.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily V member 1
  KO
K04934  
potassium channel subfamily V member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNV, Kv8.x
   27012 (KCNV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q23.2
AA seq 500 aa AA seqDB search
MPSSGRALLDSPLDSGSLTSLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALSCF
PHTRLGKLAVVVASYRRPGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG
RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES
EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVVVSIINMALMSAELSWLDLQ
LLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGSQT
TQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIF
STVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVL
ALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEML
RLKGRERASTRSSGGDDFWF
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccttccagcggcagagcgctgctggactcgccgctggacagcggctccctgacctcc
ctggactctagtgtcttctgcagcgagggtgaaggggagcccttggcgctcggggactgc
ttcacggtcaacgtgggcggcagccgcttcgtgctctcgcagcaggcgctgtcctgcttc
ccgcacacgcgccttggcaagctggccgtggtggtggcttcctaccgccgccccggggcc
ctggccgccgtgcccagccctctggagctttgcgacgatgccaaccccgtggacaacgag
tacttcttcgaccgcagctcgcaggcgttccgatatgtcctgcactactaccgcaccggc
cgcctgcatgtcatggagcagctgtgcgcgctctccttcctgcaggagatccagtactgg
ggcatcgatgagctcagcatcgattcctgctgcagggacagatacttcagaaggaaagag
ctgagtgaaactttagacttcaagaaggacacagaagaccaggaaagtcaacatgagagt
gaacaggacttctcccaaggaccttgtcccactgttcgccagaagctctggaatatcctg
gagaaacctggatcttccacagctgcccgtatctttggcgtcatctccattatcttcgtg
gtggtgtccatcattaacatggccctgatgtcagctgagttaagctggctggacctgcag
ctgctggaaatcctggagtatgtgtgcattagctggttcaccggggagtttgtcctccgc
ttcctgtgtgtgcgggacaggtgtcgcttcctaagaaaggtgccaaacatcatagacctc
cttgccatcttgcccttctacatcactcttctggtagagagcctaagtgggagccagacc
acgcaggagctggagaacgtggggcgcattgtccaggtgttgaggctgctcagggctctg
cgcatgctaaagctgggcagacattccacaggattacgctcccttgggatgacaatcacc
cagtgttacgaagaagtcggcctactgctcctatttctatccgtgggaatctctatattt
tcaactgtagaatactttgctgagcaaagcattcctgacacaaccttcacaagtgtccct
tgtgcatggtggtgggccaccacctctatgactactgtgggatatggggacattagacca
gacaccaccacaggcaaaatcgtggccttcatgtgtatattatcgggaattcttgtcttg
gccttgcctattgctattattaacgatcgcttctctgcttgctacttcaccttgaaactc
aaggaagcagctgttagacagcgtgaagccctaaagaagcttaccaagaatatagccact
gactcatatatcagtgttaacttgagagatgtctatgcccggagtatcatggagatgctg
cgactgaaaggcagagaaagagcaagtactaggagcagcgggggagatgatttctggttt
tga

DBGET integrated database retrieval system