KEGG   Homo sapiens (human): 27035Help
Entry
27035             CDS       T01001                                 

Gene name
NOX1, GP91-2, MOX1, NOH-1, NOH1
Definition
NADPH oxidase 1
Orthology
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
Leukocyte transendothelial migration
Class
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:hsa04670]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 527 aa AA seqDB search
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGFCSRTLRKQLDHN
LTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNP
IQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILG
LGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPV
ILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEW
HPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEV
AVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQ
EMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTI
ATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgggtggttaaccactggttttcagttttgtttctggttgtttggttaggg
ctgaatgttttcctgtttgtggatgccttcctgaaatatgagaaggccgacaaatactac
tacacaagaaaaatccttgggttttgcagccgcacactgagaaagcaattggatcacaac
ctcaccttccacaagctggtggcctatatgatctgcctacatacagctattcacatcatt
gcacacctgtttaactttgactgctatagcagaagccgacaggccacagatggctccctt
gcctccattctctccagcctatctcatgatgagaaaaaggggggttcttggctaaatccc
atccagtcccgaaacacgacagtggagtatgtgacattcaccagcattgctggtctcact
ggagtgatcatgacaatagccttgattctcatggtaacttcagctactgagttcatccgg
aggagttattttgaagtcttctggtatactcaccacctttttatcttctatatccttggc
ttagggattcacggcattggtggaattgtccggggtcaaacagaggagagcatgaatgag
agtcatcctcgcaagtgtgcagagtcttttgagatgtgggatgatcgtgactcccactgt
aggcgccctaagtttgaagggcatccccctgagtcttggaagtggatccttgcaccggtc
attctttatatctgtgaaaggatcctccggttttaccgctcccagcagaaggttgtgatt
accaaggttgttatgcacccatccaaagttttggaattgcagatgaacaagcgtggcttc
agcatggaagtggggcagtatatctttgttaattgcccctcaatctctctcctggaatgg
catccttttactttgacctctgctccagaggaagatttcttctccattcatatccgagca
gcaggggactggacagaaaatctcataagggctttcgaacaacaatattcaccaattccc
aggattgaagtggatggtccctttggcacagccagtgaggatgttttccagtatgaagtg
gctgtgctggttggagcaggaattggggtcaccccctttgcttctatcttgaaatccatc
tggtacaaattccagtgtgcagaccacaacctcaaaacaaaaaagatctatttctactgg
atctgcagggagacaggtgccttttcctggttcaacaacctgttgacttccctggaacag
gagatggaggaattaggcaaagtgggttttctaaactaccgtctcttcctcaccggatgg
gacagcaatattgttggtcatgcagcattaaactttgacaaggccactgacatcgtgaca
ggtctgaaacagaaaacctcctttgggagaccaatgtgggacaatgagttttctacaata
gctacctcccaccccaagtctgtagtgggagttttcttatgtggccctcggactttggca
aagagcctgcgcaaatgctgtcaccgatattccagtctggatcctagaaaggttcaattc
tacttcaacaaagaaaatttttga

DBGET integrated database retrieval system