KEGG   Homo sapiens (human): 27035Help
Entry
27035             CDS       T01001                                 

Gene name
NOX1, GP91-2, MOX1, NOH-1, NOH1
Definition
(RefSeq) NADPH oxidase 1
  KO
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
NOD-like receptor signaling pathway
Leukocyte transendothelial migration
AGE-RAGE signaling pathway in diabetic complications
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    27035 (NOX1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    27035 (NOX1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    27035 (NOX1)
   04670 Leukocyte transendothelial migration
    27035 (NOX1)
  Development
   04380 Osteoclast differentiation
    27035 (NOX1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    27035 (NOX1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    27035 (NOX1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    27035 (NOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9Y5S8(Tchem)
UniProt: 
Position
Xq22.1
AA seq 564 aa AA seqDB search
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgggtggttaaccactggttttcagttttgtttctggttgtttggttaggg
ctgaatgttttcctgtttgtggatgccttcctgaaatatgagaaggccgacaaatactac
tacacaagaaaaatccttgggtcaacattggcctgtgcccgagcgtctgctctctgcttg
aattttaacagcacgctgatcctgcttcctgtgtgtcgcaatctgctgtccttcctgagg
ggcacctgctcattttgcagccgcacactgagaaagcaattggatcacaacctcaccttc
cacaagctggtggcctatatgatctgcctacatacagctattcacatcattgcacacctg
tttaactttgactgctatagcagaagccgacaggccacagatggctcccttgcctccatt
ctctccagcctatctcatgatgagaaaaaggggggttcttggctaaatcccatccagtcc
cgaaacacgacagtggagtatgtgacattcaccagcattgctggtctcactggagtgatc
atgacaatagccttgattctcatggtaacttcagctactgagttcatccggaggagttat
tttgaagtcttctggtatactcaccacctttttatcttctatatccttggcttagggatt
cacggcattggtggaattgtccggggtcaaacagaggagagcatgaatgagagtcatcct
cgcaagtgtgcagagtcttttgagatgtgggatgatcgtgactcccactgtaggcgccct
aagtttgaagggcatccccctgagtcttggaagtggatccttgcaccggtcattctttat
atctgtgaaaggatcctccggttttaccgctcccagcagaaggttgtgattaccaaggtt
gttatgcacccatccaaagttttggaattgcagatgaacaagcgtggcttcagcatggaa
gtggggcagtatatctttgttaattgcccctcaatctctctcctggaatggcatcctttt
actttgacctctgctccagaggaagatttcttctccattcatatccgagcagcaggggac
tggacagaaaatctcataagggctttcgaacaacaatattcaccaattcccaggattgaa
gtggatggtccctttggcacagccagtgaggatgttttccagtatgaagtggctgtgctg
gttggagcaggaattggggtcaccccctttgcttctatcttgaaatccatctggtacaaa
ttccagtgtgcagaccacaacctcaaaacaaaaaagatctatttctactggatctgcagg
gagacaggtgccttttcctggttcaacaacctgttgacttccctggaacaggagatggag
gaattaggcaaagtgggttttctaaactaccgtctcttcctcaccggatgggacagcaat
attgttggtcatgcagcattaaactttgacaaggccactgacatcgtgacaggtctgaaa
cagaaaacctcctttgggagaccaatgtgggacaatgagttttctacaatagctacctcc
caccccaagtctgtagtgggagttttcttatgtggccctcggactttggcaaagagcctg
cgcaaatgctgtcaccgatattccagtctggatcctagaaaggttcaattctacttcaac
aaagaaaatttttga

DBGET integrated database retrieval system