KEGG   Homo sapiens (human): 27035Help
Entry
27035             CDS       T01001                                 

Gene name
NOX1, GP91-2, MOX1, NOH-1, NOH1
Definition
(RefSeq) NADPH oxidase 1
  KO
K08008  
NADPH oxidase
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Phagosome
Osteoclast differentiation
NOD-like receptor signaling pathway
Leukocyte transendothelial migration
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    27035 (NOX1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    27035 (NOX1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    27035 (NOX1)
   04670 Leukocyte transendothelial migration
    27035 (NOX1)
  Development
   04380 Osteoclast differentiation
    27035 (NOX1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    27035 (NOX1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    27035 (NOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.1
AA seq 564 aa AA seqDB search
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactgggtggttaaccactggttttcagttttgtttctggttgtttggttaggg
ctgaatgttttcctgtttgtggatgccttcctgaaatatgagaaggccgacaaatactac
tacacaagaaaaatccttgggtcaacattggcctgtgcccgagcgtctgctctctgcttg
aattttaacagcacgctgatcctgcttcctgtgtgtcgcaatctgctgtccttcctgagg
ggcacctgctcattttgcagccgcacactgagaaagcaattggatcacaacctcaccttc
cacaagctggtggcctatatgatctgcctacatacagctattcacatcattgcacacctg
tttaactttgactgctatagcagaagccgacaggccacagatggctcccttgcctccatt
ctctccagcctatctcatgatgagaaaaaggggggttcttggctaaatcccatccagtcc
cgaaacacgacagtggagtatgtgacattcaccagcattgctggtctcactggagtgatc
atgacaatagccttgattctcatggtaacttcagctactgagttcatccggaggagttat
tttgaagtcttctggtatactcaccacctttttatcttctatatccttggcttagggatt
cacggcattggtggaattgtccggggtcaaacagaggagagcatgaatgagagtcatcct
cgcaagtgtgcagagtcttttgagatgtgggatgatcgtgactcccactgtaggcgccct
aagtttgaagggcatccccctgagtcttggaagtggatccttgcaccggtcattctttat
atctgtgaaaggatcctccggttttaccgctcccagcagaaggttgtgattaccaaggtt
gttatgcacccatccaaagttttggaattgcagatgaacaagcgtggcttcagcatggaa
gtggggcagtatatctttgttaattgcccctcaatctctctcctggaatggcatcctttt
actttgacctctgctccagaggaagatttcttctccattcatatccgagcagcaggggac
tggacagaaaatctcataagggctttcgaacaacaatattcaccaattcccaggattgaa
gtggatggtccctttggcacagccagtgaggatgttttccagtatgaagtggctgtgctg
gttggagcaggaattggggtcaccccctttgcttctatcttgaaatccatctggtacaaa
ttccagtgtgcagaccacaacctcaaaacaaaaaagatctatttctactggatctgcagg
gagacaggtgccttttcctggttcaacaacctgttgacttccctggaacaggagatggag
gaattaggcaaagtgggttttctaaactaccgtctcttcctcaccggatgggacagcaat
attgttggtcatgcagcattaaactttgacaaggccactgacatcgtgacaggtctgaaa
cagaaaacctcctttgggagaccaatgtgggacaatgagttttctacaatagctacctcc
caccccaagtctgtagtgggagttttcttatgtggccctcggactttggcaaagagcctg
cgcaaatgctgtcaccgatattccagtctggatcctagaaaggttcaattctacttcaac
aaagaaaatttttga

DBGET integrated database retrieval system