KEGG   Homo sapiens (human): 27094Help
Entry
27094             CDS       T01001                                 

Gene name
KCNMB3, BKBETA3, HBETA3, KCNMB2, KCNMBL, SLOBETA3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    27094 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    27094 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    27094 (KCNMB3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   27094 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.3-q27
AA seq 173 aa AA seqDB search
MQPFSIPVQITLQGSRRRQGRTAFPASGKKRETDYSDGDPLDVHKRLPSSAGEDRAVMLG
FAMMGFSVLMFFLLGTTILKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGK
YPCLQVFVNLSHPGQKALLHYNEEAVQINPKRDVTDCRVKEKQTLTVSDEHKQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccccgtgcaaatcacacttcagggcagccggaggcgccagggg
aggacagcctttcctgcctcagggaagaagagagagacagactacagtgatggagaccca
ctagatgtgcacaagaggctgccatccagtgctggagaggaccgagccgtgatgctgggg
tttgccatgatgggcttctcagtcctaatgttcttcttgctcggaacaaccattctaaag
ccttttatgctcagcattcagagagaagaatcgacctgcactgccatccacacagatatc
atggacgactggctggactgtgccttcacctgtggtgtgcactgccacggtcaggggaag
tacccgtgtcttcaggtgtttgtgaacctcagccatccaggtcagaaagctctcctacat
tataatgaagaggctgtccagataaatcccaagcgtgatgttacagactgcagagttaaa
gaaaagcagacattgacagtttctgatgagcataaacagtaa

DBGET integrated database retrieval system