KEGG   Homo sapiens (human): 27115Help
Entry
27115             CDS       T01001                                 

Gene name
PDE7B, bA472E5.1
Definition
(RefSeq) phosphodiesterase 7B
  KO
K18436  
high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Morphine addiction
Drug target
Aminophylline (DG01062): 
Bucladesine (DG00230): 
Choline theophyllinate: 
Diprophylline: 
Flavoxate (DG00477): 
Moxaverine (DG00045): 
Papaverine (DG00043): 
Propentofylline: 
Proxyphylline: 
Theophylline (DG01061): 
Tibenelast sodium: 
Trapidil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    27115 (PDE7B)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    27115 (PDE7B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     27115 (PDE7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NP56(Tclin)
UniProt: 
Position
6q23.3
AA seq 450 aa AA seqDB search
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtttaatggttgagaggtgtggcgaaatcttgtttgagaaccccgatcagaat
gccaaatgtgtttgcatgctgggagatatacgactaaggggtcagacgggggttcgtgct
gaacgccgtggctcctacccattcattgacttccgcctacttaacagtacaacatactca
ggggagattggcaccaagaaaaaggtgaaaagactattaagctttcaaagatacttccat
gcatcaaggctgcttcgtggaattataccacaagcccctctgcacctgctggatgaagac
taccttggacaagcaaggcatatgctctccaaagtgggaatgtgggattttgacattttc
ttgtttgatcgcttgacaaatggaaacagcctggtaacactgttgtgccacctcttcaat
acccatggactcattcaccatttcaagttagatatggtgaccttacaccgatttttagtc
atggttcaagaagattaccacagccaaaacccgtatcacaatgctgttcacgcagccgac
gtcacccaggccatgcactgctacctgaaagagccaaagcttgccagcttcctcacgcct
ctggacatcatgcttggactgctggctgcagcagcacacgatgtggaccacccaggggtg
aaccagccatttttgataaaaactaaccaccatcttgcaaacctatatcagaatatgtct
gtgctggagaatcatcactggcgatctacaattggcatgcttcgagaatcaaggcttctt
gctcatttgccaaaggaaatgacacaggatattgaacagcagctgggctccttgatcttg
gcaacagacatcaacaggcagaatgaatttttgaccagattgaaagctcacctccacaat
aaagacttaagactggaggatgcacaggacaggcactttatgcttcagatcgccttgaag
tgtgctgacatttgcaatccttgtagaatctgggagatgagcaagcagtggagtgaaagg
gtctgtgaagaattctacaggcaaggtgaacttgaacagaaatttgaactggaaatcagt
cctctttgtaatcaacagaaagattccatccctagtatacaaattggtttcatgagctac
atcgtggagccgctcttccgggaatgggcccatttcacgggtaacagcaccctgtcggag
aacatgctgggccacctcgcacacaacaaggcccagtggaagagcctgttgcccaggcag
cacagaagcaggggcagcagtggcagcgggcctgaccacgaccacgcaggccaagggact
gagagcgaggagcaggaaggcgacagcccctag

DBGET integrated database retrieval system