KEGG   Homo sapiens (human): 27185Help
Entry
27185             CDS       T01001                                 

Gene name
DISC1, C1orf136, SCZD9
Definition
disrupted in schizophrenia 1
Orthology
K16534  
disrupted in schizophrenia 1 protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
1q42.1
AA seq 832 aa AA seqDB search
MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPA
VGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGI
QLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSA
ELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQ
SPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPG
SSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKL
QEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLE
AKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPP
ETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNH
FWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAY
ETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDER
QMDDLEGAAPPIPPRLHSEDKRKTPLKESYILSAELGEKCEDIGKKLLYLEDQLHTAIHS
HDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREAAASCMTAGVHEAQA
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgggggtcctcagggcgccccagccgccgccggcggcggcggcgtgagccac
cgcgcaggcagccgggattgcttaccacctgcagcgtgctttcggaggcggcggctggca
cggaggccgggctacatgagaagctcgacagggcctgggatcgggttcctttccccagca
gtgggcacactgttccggttcccaggaggggtgtctggcgaggagtcccaccactcggag
tccagggccagacagtgtggccttgactcgagaggcctcttggtccggagccctgtttcc
aagagtgcagcagcccctactgtgacctctgtgagaggaacctcggcgcactttgggatt
cagctcagaggtggcaccagattgcctgacaggcttagctggccgtgtggccctgggagt
gctgggtggcagcaagagtttgcagccatggatagttctgagaccctggacgccagctgg
gaggcagcctgcagcgatggagcaaggcgtgtccgggcagcaggctctctgccatcagca
gagttgagtagcaacagctgcagccctggctgtggccctgaggtccccccaacccctcct
ggctctcacagtgcctttacctcaagctttagctttattcggctctcgcttggctctgcc
ggggaacgtggagaagcagaaggctgcccaccatccagagaggctgagtcccattgccag
agcccccaggagatgggagccaaagctgccagcttggacgggcctcacgaggacccgcga
tgtctctctcggcccttcagtctcttggctacacgggtctctgcagacttggcccaggcc
gcaaggaacagctccaggccagagcgtgacatgcattctttaccagacatggaccctggc
tcctccagttctctggatccctcactggctggctgtggtggtgatgggagcagcggctca
ggggatgcccactcttgggacaccctgctcaggaaatgggagccagtgctgcgggactgc
ctgctgagaaaccggaggcagatggaggtaatatccttaagattaaaacttcagaaactt
caggaagatgcagttgagaatgatgattatgataaagctgagacgttacaacaaagatta
gaagacctggaacaagagaaaatcagcctgcactttcaacttccttcaaggcagccagct
cttagcagtttcctgggtcacctggcagcacaagtccaggctgccttgcgccgtggggcc
actcagcaggccagcggagatgacacccacaccccactgagaatggagccgaggctgttg
gaacccactgctcaggacagcttgcacgtgtccatcacgagacgagactggcttcttcag
gaaaagcagcagctacagaaagaaatcgaagctctccaagcaaggatgtttgtgctggaa
gccaaagatcaacagctgagaagggaaatagaggagcaagagcagcaactccagtggcag
ggctgcgacctgaccccactggtgggccagctgtccctgggtcagctgcaggaggtcagc
aaggccttgcaggacaccctggcctcagccggtcagattcccttccatgcagagccaccg
gaaaccataaggagcctccaggaaagaataaaatccctcaacttgtcacttaaagaaatc
actactaaggtgtgtatgagtgagaaattctgcagcaccctgaggaagaaagttaacgat
attgaaacccaactaccagccttgcttgaagccaaaatgcatgccatatcaggaaaccat
ttctggacggctaaagacctcaccgaggagattagatcattaacatcagagagagaaggg
ctggagggactcctcagcaagctgttggtgttgagttccaggaatgtcaaaaagctggga
agtgttaaagaagattacaacagactgagaagagaagtggagcaccaggagactgcctat
gaaacaagtgtgaaggaaaatactatgaagtacatggaaacacttaagaataaactgtgc
agctgcaagtgtccactgcttgggaaagtgtgggaagctgacttggaagcttgtcgattg
cttatccagagcctacagctccaggaagccaggggaagcctgtctgtagaagatgagagg
cagatggatgacttagagggagctgctcctcctattccccccaggctccactccgaggat
aaaaggaagacccctttgaaggaatcttacatcctttctgcagaacttggagaaaagtgt
gaagacataggcaagaagctattgtacttggaagatcaacttcacacagcaatccacagt
catgatgaagatctcattcagtctctcaggagggagctccagatggtgaaggaaactctg
caggccatgatcctgcagctccagccagcaaaggaggcgggagaaagagaagctgcagct
tcctgcatgacagctggtgtccacgaagcacaagcctga

DBGET integrated database retrieval system