KEGG   Homo sapiens (human): 27185Help
Entry
27185             CDS       T01001                                 

Gene name
DISC1, C1orf136, SCZD9
Definition
(RefSeq) disrupted in schizophrenia 1
  KO
K16534  
disrupted in schizophrenia 1 protein
Organism
hsa  Homo sapiens (human)
Disease
H01649  
Schizophrenia
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     27185 (DISC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q42.1
AA seq 854 aa AA seqDB search
MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPA
VGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGI
QLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSA
ELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQ
SPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPG
SSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKL
QEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLE
AKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPP
ETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNH
FWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAY
ETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDER
QMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGE
KCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA
AASCMTAGVHEAQA
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcgggggtcctcagggcgccccagccgccgccggcggcggcggcgtgagccac
cgcgcaggcagccgggattgcttaccacctgcagcgtgctttcggaggcggcggctggca
cggaggccgggctacatgagaagctcgacagggcctgggatcgggttcctttccccagca
gtgggcacactgttccggttcccaggaggggtgtctggcgaggagtcccaccactcggag
tccagggccagacagtgtggccttgactcgagaggcctcttggtccggagccctgtttcc
aagagtgcagcagcccctactgtgacctctgtgagaggaacctcggcgcactttgggatt
cagctcagaggtggcaccagattgcctgacaggcttagctggccgtgtggccctgggagt
gctgggtggcagcaagagtttgcagccatggatagttctgagaccctggacgccagctgg
gaggcagcctgcagcgatggagcaaggcgtgtccgggcagcaggctctctgccatcagca
gagttgagtagcaacagctgcagccctggctgtggccctgaggtccccccaacccctcct
ggctctcacagtgcctttacctcaagctttagctttattcggctctcgcttggctctgcc
ggggaacgtggagaagcagaaggctgcccaccatccagagaggctgagtcccattgccag
agcccccaggagatgggagccaaagctgccagcttggacgggcctcacgaggacccgcga
tgtctctctcggcccttcagtctcttggctacacgggtctctgcagacttggcccaggcc
gcaaggaacagctccaggccagagcgtgacatgcattctttaccagacatggaccctggc
tcctccagttctctggatccctcactggctggctgtggtggtgatgggagcagcggctca
ggggatgcccactcttgggacaccctgctcaggaaatgggagccagtgctgcgggactgc
ctgctgagaaaccggaggcagatggaggtaatatccttaagattaaaacttcagaaactt
caggaagatgcagttgagaatgatgattatgataaagctgagacgttacaacaaagatta
gaagacctggaacaagagaaaatcagcctgcactttcaacttccttcaaggcagccagct
cttagcagtttcctgggtcacctggcagcacaagtccaggctgccttgcgccgtggggcc
actcagcaggccagcggagatgacacccacaccccactgagaatggagccgaggctgttg
gaacccactgctcaggacagcttgcacgtgtccatcacgagacgagactggcttcttcag
gaaaagcagcagctacagaaagaaatcgaagctctccaagcaaggatgtttgtgctggaa
gccaaagatcaacagctgagaagggaaatagaggagcaagagcagcaactccagtggcag
ggctgcgacctgaccccactggtgggccagctgtccctgggtcagctgcaggaggtcagc
aaggccttgcaggacaccctggcctcagccggtcagattcccttccatgcagagccaccg
gaaaccataaggagcctccaggaaagaataaaatccctcaacttgtcacttaaagaaatc
actactaaggtgtgtatgagtgagaaattctgcagcaccctgaggaagaaagttaacgat
attgaaacccaactaccagccttgcttgaagccaaaatgcatgccatatcaggaaaccat
ttctggacggctaaagacctcaccgaggagattagatcattaacatcagagagagaaggg
ctggagggactcctcagcaagctgttggtgttgagttccaggaatgtcaaaaagctggga
agtgttaaagaagattacaacagactgagaagagaagtggagcaccaggagactgcctat
gaaacaagtgtgaaggaaaatactatgaagtacatggaaacacttaagaataaactgtgc
agctgcaagtgtccactgcttgggaaagtgtgggaagctgacttggaagcttgtcgattg
cttatccagagcctacagctccaggaagccaggggaagcctgtctgtagaagatgagagg
cagatggatgacttagagggagctgctcctcctattccccccaggctccactccgaggat
aaaaggaagacccctttgaaggtattggaagaatggaagactcacctcatcccctctctg
cactgtgctggaggtgaacagaaagaggaatcttacatcctttctgcagaacttggagaa
aagtgtgaagacataggcaagaagctattgtacttggaagatcaacttcacacagcaatc
cacagtcatgatgaagatctcattcagtctctcaggagggagctccagatggtgaaggaa
actctgcaggccatgatcctgcagctccagccagcaaaggaggcgggagaaagagaagct
gcagcttcctgcatgacagctggtgtccacgaagcacaagcctga

DBGET integrated database retrieval system