KEGG   Homo sapiens (human): 27190Help
Entry
27190             CDS       T01001                                 

Gene name
IL17B, IL-17B, IL-20, NIRF, ZCYTO7
Definition
interleukin 17B
Orthology
K05490  
interleukin 17B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27190 (IL17B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q33.1
AA seq 180 aa AA seqDB search
MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME
EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR
CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggactggcctcacaacctgctgtttcttcttaccatttccatcttcctggggctgggc
cagcccaggagccccaaaagcaagaggaaggggcaagggcggcctgggcccctggcccct
ggccctcaccaggtgccactggacctggtgtcacggatgaaaccgtatgcccgcatggag
gagtatgagaggaacatcgaggagatggtggcccagctgaggaacagctcagagctggcc
cagagaaagtgtgaggtcaacttgcagctgtggatgtccaacaagaggagcctgtctccc
tggggctacagcatcaaccacgaccccagccgtatccccgtggacctgccggaggcacgg
tgcctgtgtctgggctgtgtgaaccccttcaccatgcaggaggaccgcagcatggtgagc
gtgccggtgttcagccaggttcctgtgcgccgccgcctctgcccgccaccgccccgcaca
gggccttgccgccagcgcgcagtcatggagaccatcgctgtgggctgcacctgcatcttc
tga

DBGET integrated database retrieval system