KEGG   Homo sapiens (human): 27345Help
Entry
27345             CDS       T01001                                 

Gene name
KCNMB4
Definition
(RefSeq) potassium calcium-activated channel subfamily M regulatory beta subunit 4
  KO
K04941  potassium large conductance calcium-activated channel subfamily M beta member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    27345 (KCNMB4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    27345 (KCNMB4)
  Circulatory system
   04270 Vascular smooth muscle contraction
    27345 (KCNMB4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   27345 (KCNMB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaKB LapA_dom
Motif
Other DBs
NCBI-GeneID: 27345
NCBI-ProteinID: NP_055320
OMIM: 605223
HGNC: 6289
Ensembl: ENSG00000135643
Vega: OTTHUMG00000167586
Pharos: Q86W47(Tbio)
UniProt: Q86W47
Position
12q15
AA seq 210 aa AA seqDB search
MAKLRVAYEYTEAEDKSIRLGLFLIISGVVSLFIFGFCWLSPALQDLQATEANCTVLSVQ
QIGEVFECTFTCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
RENQKNLESVMNWQQYWKDEIGSQPFTCYFNQHQRPDDVLLHRTHDEIVLLHCFLWPLVT
FVVGVLIVVLTICAKSLAVKAEAMKKRKFS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctccgggtggcttacgagtacacggaagccgaggacaagagcatccggctc
ggcttgtttctcatcatctccggcgtcgtgtcgctcttcatcttcggcttctgctggctg
agtcccgcgctgcaggatctgcaagccacggaggccaattgcacggtgctgtcggtgcag
cagatcggcgaggtgttcgagtgcaccttcacctgtggcgccgactgcaggggcacctcg
cagtacccctgcgtccaggtctacgtgaacaactctgagtccaactctagggcgctgctg
cacagcgacgagcaccagctcctgaccaaccccaagtgctcctatatccctccctgtaag
agagaaaatcagaagaatttggaaagtgtcatgaattggcaacagtactggaaagatgag
attggttcccagccatttacttgctattttaatcaacatcaaagaccagatgatgtgctt
ctgcatcgcactcatgatgagattgtcctcctgcattgcttcctctggcccctggtgaca
tttgtggtgggcgttctcattgtggtcctgaccatctgtgccaagagcttggcggtcaag
gcggaagccatgaagaagcgcaagttctcttaa

DBGET integrated database retrieval system