KEGG   Homo sapiens (human): 2747Help
Entry
2747              CDS       T01001                                 

Gene name
GLUD2, GDH2, GLUDP1
Definition
(RefSeq) glutamate dehydrogenase 2
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Necroptosis
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2747 (GLUD2)
  Energy metabolism
   00910 Nitrogen metabolism
    2747 (GLUD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2747 (GLUD2)
   00220 Arginine biosynthesis
    2747 (GLUD2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2747 (GLUD2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    2747 (GLUD2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2747 (GLUD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     2747 (GLUD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2747 (GLUD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49448(Tbio)
UniProt: 
Position
Xq24
AA seq 558 aa AA seqDB search
MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADR
EDDPNFFKMVEGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTENELEKITRRFTMELAKKGFIGPGVDVPAPDMNTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFR
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGK
HGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYV
NAIEKVFKVYSEAGVTFT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgctacctggccaaagcgctgctgccgtcccgggccgggcccgctgccctgggc
tccgcggccaaccactcggccgcgttgctgggccggggccgcggacagcccgccgccgcc
tcgcagccggggctcgcattggccgcccggcgccactacagcgagttggtggccgaccgc
gaggacgaccccaacttcttcaagatggtggagggcttcttcgatcgcggcgccagcatc
gtggaggacaagttggtgaaggacctgaggacccaggaaagcgaggagcagaagcggaac
cgggtgcgcggcatcctgcggatcatcaagccctgcaaccatgtgctgagtctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgatgtgagtgtagatgaa
gtaaaagctttggcttctctgatgacatacaagtgtgcagtggttgatgtgccgtttggg
ggtgctaaagctggtgttaagatcaatcccaagaactataccgaaaatgaattggaaaag
atcacaaggaggttcaccatggagctagcaaagaagggctttattggtcctggcgttgat
gtgcctgctccagacatgaacacaggtgagcgggagatgtcctggattgctgatacctat
gccagcaccatagggcactatgatattaatgcacacgcctgtgttactggtaaacccatc
agccaagggggaatccatggacgcatctctgctactggccgtggtgtcttccatgggatt
gaaaacttcatcaatgaagcttcttacatgagcattttaggaatgacaccagggtttaga
gataaaacatttgttgttcagggatttggtaatgtgggcctacactctatgagatattta
catcgttttggtgctaaatgtattgctgttggtgagtctgatgggagtatatggaatcca
gatggtattgacccaaaggaactggaagacttcaaattgcaacatgggtccattctgggc
ttccccaaggcaaagccctatgaaggaagcatcttggaggtcgactgtgacatactgatc
ccagctgccactgagaagcagttgaccaaatccaacgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaacaactccagaagctgataagatcttcctggagaga
aacattttggttattccagatctctacttgaatgctggaggagtgacagtatcttacttt
gagtggctgaagaatctaaatcatgtcagctatggccgtttgaccttcaaatatgaaagg
gattctaactaccacttgctcctgtctgttcaagagagtttagaaagaaaatttggaaag
catggtggaactattcccattgtacccacggcagagttccaagacagtatatcgggtgca
tctgagaaagacattgtgcactctgccttggcatacacaatggagcgttctgccaggcaa
attatgcacacagccatgaagtataacctgggattggacctgagaacagctgcctatgtc
aatgccattgaaaaagtcttcaaagtgtacagtgaagctggtgtgaccttcacatag

DBGET integrated database retrieval system