KEGG   Homo sapiens (human): 2747Help
Entry
2747              CDS       T01001                                 

Gene name
GLUD2, GDH2, GLUDP1
Definition
(RefSeq) glutamate dehydrogenase 2
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Necroptosis
Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    2747 (GLUD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2747 (GLUD2)
   00220 Arginine biosynthesis
    2747 (GLUD2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2747 (GLUD2)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    2747 (GLUD2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2747 (GLUD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     2747 (GLUD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2747 (GLUD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49448(Tbio)
UniProt: 
Position
Xq24
AA seq 558 aa AA seqDB search
MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADR
EDDPNFFKMVEGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTENELEKITRRFTMELAKKGFIGPGVDVPAPDMNTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFR
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGK
HGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYV
NAIEKVFKVYSEAGVTFT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgctacctggccaaagcgctgctgccgtcccgggccgggcccgctgccctgggc
tccgcggccaaccactcggccgcgttgctgggccggggccgcggacagcccgccgccgcc
tcgcagccggggctcgcattggccgcccggcgccactacagcgagttggtggccgaccgc
gaggacgaccccaacttcttcaagatggtggagggcttcttcgatcgcggcgccagcatc
gtggaggacaagttggtgaaggacctgaggacccaggaaagcgaggagcagaagcggaac
cgggtgcgcggcatcctgcggatcatcaagccctgcaaccatgtgctgagtctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgatgtgagtgtagatgaa
gtaaaagctttggcttctctgatgacatacaagtgtgcagtggttgatgtgccgtttggg
ggtgctaaagctggtgttaagatcaatcccaagaactataccgaaaatgaattggaaaag
atcacaaggaggttcaccatggagctagcaaagaagggctttattggtcctggcgttgat
gtgcctgctccagacatgaacacaggtgagcgggagatgtcctggattgctgatacctat
gccagcaccatagggcactatgatattaatgcacacgcctgtgttactggtaaacccatc
agccaagggggaatccatggacgcatctctgctactggccgtggtgtcttccatgggatt
gaaaacttcatcaatgaagcttcttacatgagcattttaggaatgacaccagggtttaga
gataaaacatttgttgttcagggatttggtaatgtgggcctacactctatgagatattta
catcgttttggtgctaaatgtattgctgttggtgagtctgatgggagtatatggaatcca
gatggtattgacccaaaggaactggaagacttcaaattgcaacatgggtccattctgggc
ttccccaaggcaaagccctatgaaggaagcatcttggaggtcgactgtgacatactgatc
ccagctgccactgagaagcagttgaccaaatccaacgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaacaactccagaagctgataagatcttcctggagaga
aacattttggttattccagatctctacttgaatgctggaggagtgacagtatcttacttt
gagtggctgaagaatctaaatcatgtcagctatggccgtttgaccttcaaatatgaaagg
gattctaactaccacttgctcctgtctgttcaagagagtttagaaagaaaatttggaaag
catggtggaactattcccattgtacccacggcagagttccaagacagtatatcgggtgca
tctgagaaagacattgtgcactctgccttggcatacacaatggagcgttctgccaggcaa
attatgcacacagccatgaagtataacctgggattggacctgagaacagctgcctatgtc
aatgccattgaaaaagtcttcaaagtgtacagtgaagctggtgtgaccttcacatag

DBGET integrated database retrieval system