KEGG   Homo sapiens (human): 2770Help
Entry
2770              CDS       T01001                                 

Gene name
GNAI1, Gi
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  
guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Sphingolipid signaling pathway
Adrenergic signaling in cardiomyocytes
Axon guidance
Tight junction
Gap junction
Platelet activation
Leukocyte transendothelial migration
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Gastric acid secretion
Parkinson's disease
Cocaine addiction
Morphine addiction
Alcoholism
Pertussis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Pathways in cancer
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2770 (GNAI1)
   04071 Sphingolipid signaling pathway
    2770 (GNAI1)
   04024 cAMP signaling pathway
    2770 (GNAI1)
   04022 cGMP - PKG signaling pathway
    2770 (GNAI1)
 Cellular Processes
  Cellular community
   04530 Tight junction
    2770 (GNAI1)
   04540 Gap junction
    2770 (GNAI1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2770 (GNAI1)
   04670 Leukocyte transendothelial migration
    2770 (GNAI1)
   04062 Chemokine signaling pathway
    2770 (GNAI1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    2770 (GNAI1)
   04915 Estrogen signaling pathway
    2770 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    2770 (GNAI1)
   04921 Oxytocin signaling pathway
    2770 (GNAI1)
   04916 Melanogenesis
    2770 (GNAI1)
   04924 Renin secretion
    2770 (GNAI1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2770 (GNAI1)
  Digestive system
   04971 Gastric acid secretion
    2770 (GNAI1)
  Nervous system
   04724 Glutamatergic synapse
    2770 (GNAI1)
   04727 GABAergic synapse
    2770 (GNAI1)
   04725 Cholinergic synapse
    2770 (GNAI1)
   04728 Dopaminergic synapse
    2770 (GNAI1)
   04726 Serotonergic synapse
    2770 (GNAI1)
   04730 Long-term depression
    2770 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    2770 (GNAI1)
  Development
   04360 Axon guidance
    2770 (GNAI1)
  Environmental adaptation
   04713 Circadian entrainment
    2770 (GNAI1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2770 (GNAI1)
  Neurodegenerative diseases
   05012 Parkinson's disease
    2770 (GNAI1)
  Substance dependence
   05030 Cocaine addiction
    2770 (GNAI1)
   05032 Morphine addiction
    2770 (GNAI1)
   05034 Alcoholism
    2770 (GNAI1)
  Infectious diseases
   05133 Pertussis
    2770 (GNAI1)
   05145 Toxoplasmosis
    2770 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    2770 (GNAI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2770 (GNAI1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2770 (GNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgtgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacaatacaaagcagtggtctacagtaacaccatccagtca
attattgctatcattagggctatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcatactatttgaatgacttggac
agaatagctcaaccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgacctggttctagctgaagatgaagaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatatgtaacaacaagtggtttaca
gatacatccattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttttaa

DBGET integrated database retrieval system