KEGG   Homo sapiens (human): 2775Help
Entry
2775              CDS       T01001                                 

Gene name
GNAO1, EIEE17, G-ALPHA-o, GNAO
Definition
guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Orthology
K04534  
guanine nucleotide-binding protein G(o) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Morphine addiction
Alcoholism
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2775 (GNAO1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2775 (GNAO1)
   04921 Oxytocin signaling pathway
    2775 (GNAO1)
   04916 Melanogenesis
    2775 (GNAO1)
  Nervous system
   04724 Glutamatergic synapse
    2775 (GNAO1)
   04727 GABAergic synapse
    2775 (GNAO1)
   04725 Cholinergic synapse
    2775 (GNAO1)
   04728 Dopaminergic synapse
    2775 (GNAO1)
   04726 Serotonergic synapse
    2775 (GNAO1)
   04730 Long-term depression
    2775 (GNAO1)
   04723 Retrograde endocannabinoid signaling
    2775 (GNAO1)
  Environmental adaptation
   04713 Circadian entrainment
    2775 (GNAO1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    2775 (GNAO1)
   05034 Alcoholism
    2775 (GNAO1)
  Infectious diseases
   05145 Toxoplasmosis
    2775 (GNAO1)
   05142 Chagas disease (American trypanosomiasis)
    2775 (GNAO1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2775 (GNAO1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [Table]
    2775 (GNAO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q13
AA seq 354 aa AA seqDB search
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctcggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctccggagaagacgtgaaacagtacaagcctgttgtctacagcaacactatccagtcc
ctggcagccatcgtccgggccatggacactttgggcatcgaatatggtgataaggagaga
aaggctgacgccaagatggtgtgtgatgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttctgccatgatgcggctctggggcgactcaggaatccaagagtgc
ttcaaccggtcccgggagtatcagctcaacgactctgccaaatactacctggacagcctg
gatcggattggggccgccgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccactggcatcgtagaaacccacttcacattcaagaacctccacttcaggctgttt
gacgtcggaggccagcgatctgaacgcaagaagtggatccattgcttcgaggacgtcacg
gccatcattttctgtgtcgcgctcagcggctatgaccaggtgctccacgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagttcttc
atcgatacctccatcattctcttcctcaacaagaaagatctctttggcgagaagatcaag
aagtcacctttgaccatctgctttcctgaatacacaggccccaatacctatgaagacgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatatat
tgtcacatgacttgtgccacagacacgaataacatccaggtggtgttcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

DBGET integrated database retrieval system