KEGG   Homo sapiens (human): 2775Help
Entry
2775              CDS       T01001                                 

Gene name
GNAO1, EIEE17, G-ALPHA-o, GNAO
Definition
guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Orthology
K04534  
guanine nucleotide-binding protein G(o) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Morphine addiction
Alcoholism
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q13
AA seq 354 aa AA seqDB search
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDG
FSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
SAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRV
KTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDET
TNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDA
AAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtactctgagcgcagaggagagagccgccctcgagcggagcaaggcgattgag
aaaaacctcaaagaggatggcatcagcgccgccaaagacgtgaaattactcctgctcggg
gctggagaatcaggaaaaagcaccattgtgaagcagatgaagatcatccatgaagatggc
ttctccggagaagacgtgaaacagtacaagcctgttgtctacagcaacactatccagtcc
ctggcagccatcgtccgggccatggacactttgggcatcgaatatggtgataaggagaga
aaggctgacgccaagatggtgtgtgatgtggtgagtcggatggaagacaccgagcccttc
tctgcagagctgctttctgccatgatgcggctctggggcgactcaggaatccaagagtgc
ttcaaccggtcccgggagtatcagctcaacgactctgccaaatactacctggacagcctg
gatcggattggggccgccgactaccagcccaccgagcaggacatcctccgaaccagggtc
aaaaccactggcatcgtagaaacccacttcacattcaagaacctccacttcaggctgttt
gacgtcggaggccagcgatctgaacgcaagaagtggatccattgcttcgaggacgtcacg
gccatcattttctgtgtcgcgctcagcggctatgaccaggtgctccacgaagacgaaacc
acgaaccgcatgcacgagtctctcatgctcttcgactccatctgtaacaacaagttcttc
atcgatacctccatcattctcttcctcaacaagaaagatctctttggcgagaagatcaag
aagtcacctttgaccatctgctttcctgaatacacaggccccaatacctatgaagacgca
gccgcctacatccaagcacaatttgaaagcaaaaaccgctcacccaacaaagaaatatat
tgtcacatgacttgtgccacagacacgaataacatccaggtggtgttcgacgccgtcacc
gacatcatcattgccaacaacctccggggctgcggcttgtactga

DBGET integrated database retrieval system