KEGG   Homo sapiens (human): 2776Help
Entry
2776              CDS       T01001                                 

Gene name
GNAQ, CMC1, G-ALPHA-q, GAQ, SWS
Definition
guanine nucleotide binding protein (G protein), q polypeptide
Orthology
K04634  
guanine nucleotide-binding protein G(q) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2776 (GNAQ)
   04020 Calcium signaling pathway
    2776 (GNAQ)
   04022 cGMP - PKG signaling pathway
    2776 (GNAQ)
 Cellular Processes
  Cell communication
   04540 Gap junction
    2776 (GNAQ)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2776 (GNAQ)
  Endocrine system
   04911 Insulin secretion
    2776 (GNAQ)
   04912 GnRH signaling pathway
    2776 (GNAQ)
   04915 Estrogen signaling pathway
    2776 (GNAQ)
   04921 Oxytocin signaling pathway
    2776 (GNAQ)
   04918 Thyroid hormone synthesis
    2776 (GNAQ)
   04916 Melanogenesis
    2776 (GNAQ)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2776 (GNAQ)
   04270 Vascular smooth muscle contraction
    2776 (GNAQ)
  Digestive system
   04970 Salivary secretion
    2776 (GNAQ)
   04971 Gastric acid secretion
    2776 (GNAQ)
   04972 Pancreatic secretion
    2776 (GNAQ)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    2776 (GNAQ)
  Nervous system
   04724 Glutamatergic synapse
    2776 (GNAQ)
   04725 Cholinergic synapse
    2776 (GNAQ)
   04728 Dopaminergic synapse
    2776 (GNAQ)
   04726 Serotonergic synapse
    2776 (GNAQ)
   04720 Long-term potentiation
    2776 (GNAQ)
   04730 Long-term depression
    2776 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    2776 (GNAQ)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2776 (GNAQ)
  Environmental adaptation
   04713 Circadian entrainment
    2776 (GNAQ)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2776 (GNAQ)
   05016 Huntington's disease
    2776 (GNAQ)
  Infectious diseases
   05146 Amoebiasis
    2776 (GNAQ)
   05142 Chagas disease (American trypanosomiasis)
    2776 (GNAQ)
   05143 African trypanosomiasis
    2776 (GNAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2776 (GNAQ)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    2776 (GNAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q21
AA seq 359 aa AA seqDB search
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tacccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacgtgcgccacagacaccgagaatatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system