KEGG   Homo sapiens (human): 2776Help
Entry
2776              CDS       T01001                                 

Gene name
GNAQ, CMC1, G-ALPHA-q, GAQ, SWS
Definition
guanine nucleotide binding protein (G protein), q polypeptide
Orthology
K04634  
guanine nucleotide-binding protein G(q) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
Human Diseases; Infectious diseases; African trypanosomiasis [PATH:hsa05143]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q21
AA seq 359 aa AA seqDB search
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tacccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacgtgcgccacagacaccgagaatatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system