KEGG   Homo sapiens (human): 2778Help
Entry
2778              CDS       T01001                                 

Gene name
GNAS, AHO, C20orf45, GNAS1, GPSA, GSA, GSP, NESP, PHP1A, PHP1B, PHP1C, POH
Definition
GNAS complex locus
Orthology
K04632  
guanine nucleotide-binding protein G(s) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Glutamatergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Vibrio cholerae infection
Chagas disease (American trypanosomiasis)
Amoebiasis
Pathways in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Disease
H00244  
Pseudohypoparathyroidism
H00441  
Progressive osseous heteroplasia (POH)
H00501  
Fibrous dysplasia, polyostotic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2778 (GNAS)
   04020 Calcium signaling pathway
    2778 (GNAS)
   04024 cAMP signaling pathway
    2778 (GNAS)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    2778 (GNAS)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2778 (GNAS)
  Endocrine system
   04911 Insulin secretion
    2778 (GNAS)
   04912 GnRH signaling pathway
    2778 (GNAS)
   04913 Ovarian Steroidogenesis
    2778 (GNAS)
   04915 Estrogen signaling pathway
    2778 (GNAS)
   04921 Oxytocin signaling pathway
    2778 (GNAS)
   04918 Thyroid hormone synthesis
    2778 (GNAS)
   04916 Melanogenesis
    2778 (GNAS)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2778 (GNAS)
   04270 Vascular smooth muscle contraction
    2778 (GNAS)
  Digestive system
   04970 Salivary secretion
    2778 (GNAS)
   04971 Gastric acid secretion
    2778 (GNAS)
   04972 Pancreatic secretion
    2778 (GNAS)
   04976 Bile secretion
    2778 (GNAS)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    2778 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    2778 (GNAS)
  Nervous system
   04724 Glutamatergic synapse
    2778 (GNAS)
   04728 Dopaminergic synapse
    2778 (GNAS)
   04726 Serotonergic synapse
    2778 (GNAS)
   04730 Long-term depression
    2778 (GNAS)
  Sensory system
   04742 Taste transduction
    2778 (GNAS)
   04750 Inflammatory mediator regulation of TRP channels
    2778 (GNAS)
  Environmental adaptation
   04713 Circadian entrainment
    2778 (GNAS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2778 (GNAS)
  Substance dependence
   05030 Cocaine addiction
    2778 (GNAS)
   05031 Amphetamine addiction
    2778 (GNAS)
   05032 Morphine addiction
    2778 (GNAS)
   05034 Alcoholism
    2778 (GNAS)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    2778 (GNAS)
  Infectious diseases
   05110 Vibrio cholerae infection
    2778 (GNAS)
   05146 Amoebiasis
    2778 (GNAS)
   05142 Chagas disease (American trypanosomiasis)
    2778 (GNAS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2778 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   2778 (GNAS)
  Exosomal proteins of colorectal cancer cells
   2778 (GNAS)
  Exosomal proteins of bladder cancer cells
   2778 (GNAS)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    2778 (GNAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.3
AA seq 394 aa AA seqDB search
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcctcgggaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgt
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaa
gaggcgattgaaaccattgtggccgccatgagcaacctggtgccccccgtggagctggcc
aaccccgagaaccagttcagagtggactacatcctgagtgtgatgaacgtgcctgacttt
gacttccctcccgaattctatgagcatgccaaggctctgtgggaggatgaaggagtgcgt
gcctgctacgaacgctccaacgagtaccagctgattgactgtgcccagtacttcctggac
aagatcgacgtgatcaagcaggctgactatgtgccgagcgatcaggacctgcttcgctgc
cgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttccac
atgtttgacgtgggtggccagcgcgatgaacgccgcaagtggatccagtgcttcaacgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgggaggac
aaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgatcctgttcctcaacaagcaagatctgctcgctgagaaa
gtccttgctgggaaatcgaagattgaggactactttccagaatttgctcgctacactact
cctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
attcgagatgagtttctgaggatcagcactgccagtggagatgggcgtcactactgctac
cctcatttcacctgcgctgtggacactgagaacatccgccgtgtgttcaacgactgccgt
gacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

DBGET integrated database retrieval system