KEGG   Homo sapiens (human): 2778Help
Entry
2778              CDS       T01001                                 

Gene name
GNAS, AHO, C20orf45, GNAS1, GPSA, GSA, GSP, NESP, PHP1A, PHP1B, PHP1C, POH
Definition
GNAS complex locus
Orthology
K04632  
guanine nucleotide-binding protein G(s) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Glutamatergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Vibrio cholerae infection
Chagas disease (American trypanosomiasis)
Amoebiasis
Dilated cardiomyopathy
Disease
H00244  
Pseudohypoparathyroidism
H00441  
Progressive osseous heteroplasia (POH)
H00501  
Fibrous dysplasia, polyostotic
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:hsa04912]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:hsa04913]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:hsa04918]
Organismal Systems; Endocrine system; Melanogenesis [PATH:hsa04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:hsa04970]
Organismal Systems; Digestive system; Gastric acid secretion [PATH:hsa04971]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
Organismal Systems; Excretory system; Vasopressin-regulated water reabsorption [PATH:hsa04962]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:hsa04726]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
Organismal Systems; Sensory system; Taste transduction [PATH:hsa04742]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:hsa04750]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.3
AA seq 394 aa AA seqDB search
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcctcgggaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgt
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaagcagatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctgaaa
gaggcgattgaaaccattgtggccgccatgagcaacctggtgccccccgtggagctggcc
aaccccgagaaccagttcagagtggactacatcctgagtgtgatgaacgtgcctgacttt
gacttccctcccgaattctatgagcatgccaaggctctgtgggaggatgaaggagtgcgt
gcctgctacgaacgctccaacgagtaccagctgattgactgtgcccagtacttcctggac
aagatcgacgtgatcaagcaggctgactatgtgccgagcgatcaggacctgcttcgctgc
cgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttccac
atgtttgacgtgggtggccagcgcgatgaacgccgcaagtggatccagtgcttcaacgat
gtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgggaggac
aaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgatcctgttcctcaacaagcaagatctgctcgctgagaaa
gtccttgctgggaaatcgaagattgaggactactttccagaatttgctcgctacactact
cctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
attcgagatgagtttctgaggatcagcactgccagtggagatgggcgtcactactgctac
cctcatttcacctgcgctgtggacactgagaacatccgccgtgtgttcaacgactgccgt
gacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

DBGET integrated database retrieval system