KEGG   Homo sapiens (human): 2781Help
Entry
2781              CDS       T01001                                 

Gene name
GNAZ, gz-alpha
Definition
(RefSeq) G protein subunit alpha z
  KO
K04535  guanine nucleotide-binding protein G(z) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04730  Long-term depression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04730 Long-term depression
    2781 (GNAZ)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2781 (GNAZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29 TniB AAA_16
Motif
Other DBs
NCBI-GeneID: 2781
NCBI-ProteinID: NP_002064
OMIM: 139160
HGNC: 4395
Ensembl: ENSG00000128266
Vega: OTTHUMG00000150611
Pharos: P19086(Tbio)
UniProt: P19086 Q8IY73
Position
22q11.22-q11.23
AA seq 355 aa AA seqDB search
MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSGKSTIVKQMKIIHSGG
FNLEACKEYKPLIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEI
TPELLGVMRRLWADPGAQACFSRSSEYHLEDNAAYYLNDLERIAAADYIPTVEDILRSRD
MTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAIIFCVELSGYDLKLYEDNQ
TSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEA
AVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLKYIGLC
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtcggcaaagctcagaggaaaaagaagcagcccggcggtcccggagaattgac
cgccacctgcgctcagagagccagcggcaacgccgcgaaatcaagctgctcctgctgggc
accagcaactcaggcaagagcaccatcgtcaaacagatgaagatcatccacagcggcggc
ttcaacctggaggcctgcaaggagtacaagcccctcatcatctacaatgccatcgactcg
ctgacccgcatcatccgggccctggccgccctcaggatcgacttccacaaccccgaccgc
gcctacgacgctgtgcagctctttgcgctgacgggccccgctgagagcaagggcgagatc
acacccgagctgctgggtgtcatgcgacggctctgggccgacccaggggcacaggcctgc
ttcagccgctccagcgagtaccacctggaggacaacgcggcctactacctgaacgacctg
gagcgcatcgccgcagctgactatatccccactgtcgaggacatcctgcgctcccgggac
atgaccacgggcattgtggagaacaagttcaccttcaaggagctcaccttcaagatggtg
gacgtgggggggcagaggtcagagcgcaaaaagtggatccactgcttcgagggcgtcaca
gccatcatcttctgtgtggagctcagcggctacgacctgaaactctacgaggataaccag
acaagtcggatggcagagagcttgcgcctctttgactccatctgcaacaacaactggttc
atcaacacctcactcatcctcttcctgaacaagaaggacctgctggcagagaagatccgc
cgcatcccgctcaccatctgctttcccgagtacaagggccagaacacgtacgaggaggcc
gctgtctacatccagcggcagtttgaagacctgaaccgcaacaaggagaccaaggagatc
tactcccacttcacctgcgccaccgacaccagtaacatccagtttgtcttcgacgcggtg
acagacgtcatcatacagaacaatctcaagtacattggcctttgctga

DBGET integrated database retrieval system