KEGG   Homo sapiens (human): 279Help
Entry
279               CDS       T01001                                 

Gene name
AMY2A, AMY2, PA
Definition
(RefSeq) amylase, alpha 2A (pancreatic) (EC:3.2.1.1)
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Pancreatic secretion
Carbohydrate digestion and absorption
Drug target
Acarbose: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    279 (AMY2A)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    279 (AMY2A)
   04973 Carbohydrate digestion and absorption
    279 (AMY2A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     279 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p21
AA seq 511 aa AA seqDB search
MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGL
LDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgcttttcaccattgggttctgctgggctcagtattccccaaat
acacaacaaggacggacatctattgttcatctgtttgaatggcgatgggttgatattgct
cttgaatgtgagcgatatttagctccgaagggatttggaggggttcaggtctctccacca
aatgaaaatgttgcaatttacaaccctttcagaccttggtgggaaagataccaaccagtt
agctataaattatgcacaagatctggaaatgaagatgaatttagaaacatggtgactaga
tgtaacaatgttggggttcgtatttatgtggatgctgtaattaatcatatgtgtggtaac
gctgtgagtgcaggaacaagcagtacctgtggaagttacttcaaccctggaagtagggac
tttccagcagtcccatattctggatgggatttcaatgatggtaaatgtaaaactggaagt
ggagatatcgagaactacaatgatgctactcaggtcagagattgtcgtctgactggtctt
cttgatcttgcactggagaaggattacgtgcgttctaagattgccgaatatatgaaccat
ctcattgacattggtgttgcagggttcagacttgatgcttccaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctaaacagtaactggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gactactttggtaatggccgggtgacagaattcaagtatggtgcaaaactcggcacagtt
attcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggttggggt
ttcgtaccttctgacagagcgcttgtctttgtggataaccatgacaatcaacgaggacat
ggggctggaggagcctctattcttaccttctgggatgctaggctgtacaaaatggcagtt
ggatttatgcttgctcatccttacggatttacacgagtaatgtcaagctaccgttggcca
agacagtttcaaaatggaaacgatgttaatgattgggttgggccaccaaataataatgga
gtaattaaagaagttactattaatccagacactacttgtggcaatgactgggtctgtgaa
catcgatggcgccaaataaggaacatggttattttccgcaatgtagtggatggccagcct
tttacaaattggtatgataatgggagcaaccaagtggcttttgggagaggaaacagagga
ttcattgttttcaacaatgatgactggtcattttctttaactttgcaaactggtcttcct
gctggcacatactgtgatgtcatttctggagataaaattaatggcaattgcacaggcatt
aaaatttacgtttctgatgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgaatctaaattgtaa

DBGET integrated database retrieval system