KEGG   Homo sapiens (human): 28Help
Entry
28                CDS       T01001                                 

Gene name
ABO, A3GALNT, A3GALT1, GTB, NAGAT
Definition
ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase) (EC:2.4.1.37 2.4.1.40)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.2
AA seq 354 aa AA seqDB search
MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggtgttgcggacgctggccggaaaaccaaaatgccacgcacttcgacctatg
atccttttcctaataatgcttgtcttggtcttgtttggttacggggtcctaagccccaga
agtctaatgccaggaagcctggaacgggggttctgcatggctgttagggaacctgaccat
ctgcagcgcgtctcgttgccaaggatggtctacccccagccaaaggtgctgacaccgtgt
aggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgggagggcacattc
aacatcgacatcctcaacgagcagttcaggctccagaacaccaccattgggttaactgtg
tttgccatcaagaaatacgtggctttcctgaagctgttcctggagacggcggagaagcac
ttcatggtgggccaccgtgtccactactatgtcttcaccgaccagccggccgcggtgccc
cgcgtgacgctggggaccggtcggcagctgtcagtgctggaggtgcgcgcctacaagcgc
tggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgcgagcggcgcttc
ctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttccgcgaccacgtg
ggcgtggagatcctgactccgctgttcggcaccctgcaccccggcttctacggaagcagc
cgggaggccttcacctacgagcgccggccccagtcccaggcctacatccccaaggacgag
ggcgatttctactacctgggggggttcttcggggggtcggtgcaagaggtgcagcggctc
accagggcctgccaccaggccatgatggtcgaccaggccaacggcatcgaggccgtgtgg
cacgacgagagccacctgaacaagtacctgctgcgccacaaacccaccaaggtgctctcc
cccgagtacttgtgggaccagcagctgctgggctggcccgccgtcctgaggaagctgagg
ttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system