KEGG   Homo sapiens (human): 2821Help
Entry
2821              CDS       T01001                                 

Gene name
GPI, AMF, GNPI, NLK, PGI, PHI, SA-36, SA36
Definition
glucose-6-phosphate isomerase (EC:5.3.1.9)
Orthology
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Pentose phosphate pathway (Pentose phosphate cycle)
Disease
H00664  
Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2821 (GPI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2821 (GPI)
   00030 Pentose phosphate pathway
    2821 (GPI)
   00500 Starch and sucrose metabolism
    2821 (GPI)
   00520 Amino sugar and nucleotide sugar metabolism
    2821 (GPI)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     2821 (GPI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2821 (GPI)
  Exosomal proteins of other body fluids (saliva and urine)
   2821 (GPI)
  Exosomal proteins of colorectal cancer cells
   2821 (GPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 558 aa AA seqDB search
MAALTRDPQFQKLQQWYREHRSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggccgctctcacccgggacccccagttccagaagctgcagcaatggtaccgcgagcac
cgctccgagctgaacctgcgccgcctcttcgatgccaacaaggaccgcttcaaccacttc
agcttgaccctcaacaccaaccatgggcatatcctggtggattactccaagaacctggtg
acggaggacgtgatgcggatgctggtggacttggccaagtccaggggcgtggaggccgcc
cgggagcggatgttcaatggtgagaagatcaactacaccgagggtcgagccgtgctgcac
gtggctctgcggaaccggtcaaacacacccatcctggtagacggcaaggatgtgatgcca
gaggtcaacaaggttctggacaagatgaagtctttctgccagcgtgtccggagcggtgac
tggaaggggtacacaggcaagaccatcacggacgtcatcaacattggcattggcggctcc
gacctgggacccctcatggtgactgaagcccttaagccatactcttcaggaggtccccgc
gtctggtatgtctccaacattgatggaactcacattgccaaaaccctggcccagctgaac
cccgagtcctccctgttcatcattgcctccaagacctttactacccaggagaccatcacg
aatgcagagacggcgaaggagtggtttctccaggcggccaaggatccttctgcagtggcg
aagcactttgttgccctgtctactaacacaaccaaagtgaaggagtttggaattgaccct
caaaacatgttcgagttctgggattgggtgggaggacgctactcgctgtggtcggccatc
ggactctccattgccctgcacgtgggttttgacaacttcgagcagctgctctcgggggct
cactggatggaccagcacttccgcacgacgcccctggagaagaacgcccccgtcttgctg
gccctgctgggtatctggtacatcaactgctttgggtgtgagacacacgccatgctgccc
tatgaccagtacctgcaccgctttgctgcgtacttccagcagggcgacatggagtccaat
gggaaatacatcaccaaatctggaacccgtgtggaccaccagacaggccccattgtgtgg
ggggagccagggaccaatggccagcatgctttttaccagctcatccaccaaggcaccaag
atgataccctgtgacttcctcatcccggtccagacccagcaccccatacggaagggtctg
catcacaagatcctcctggccaacttcttggcccagacagaggccctgatgaggggaaaa
tcgacggaggaggcccgaaaggagctccaggctgcgggcaagagtccagaggaccttgag
aggctgctgccacataaggtctttgaaggaaatcgcccaaccaactctattgtgttcacc
aagctcacaccattcatgcttggagccttggtcgccatgtatgagcacaagatcttcgtt
cagggcatcatctgggacatcaacagctttgaccagtggggagtggagctgggaaagcag
ctggctaagaaaatagagcctgagcttgatggcagtgctcaagtgacctctcacgacgct
tctaccaatgggctcatcaacttcatcaagcagcagcgcgaggccagagtccaataa

DBGET integrated database retrieval system