KEGG   Homo sapiens (human): 284217Help
Entry
284217            CDS       T01001                                 

Gene name
LAMA1, LAMA, S-LAM-alpha
Definition
laminin, alpha 1
Orthology
K05637  
laminin, alpha 1/2
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    284217 (LAMA1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    284217 (LAMA1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    284217 (LAMA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    284217 (LAMA1)
   05222 Small cell lung cancer
    284217 (LAMA1)
  Infectious diseases
   05146 Amoebiasis
    284217 (LAMA1)
   05145 Toxoplasmosis
    284217 (LAMA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.3
AA seq 3075 aa AA seqDB search
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES
NT seq 9228 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgggggcgtgctcctggtcttgctgctgtgtgtcgccgcgcagtgccggcagaga
ggcctgtttcctgccattctcaatcttgccagcaatgctcacatcagcaccaatgccacc
tgtggcgagaaggggccggagatgttctgcaaacttgtggagcatgtgccaggtcggccc
gtccgaaacccacagtgccggatctgtgatggcaacagcgcaaaccccagagaacgccat
ccaatatcacatgccatagatggcaccaataactggtggcaaagtcccagcattcagaat
gggagagaatatcactgggtcacaatcactctggacttaagacaggtctttcaagttgca
tatgtcatcattaaagctgccaatgcccctcgacctggaaactggattttggagcgttct
ctggatggcaccacgttcagcccctggcagtattatgcagtcagcgactcagagtgtttg
tctcgttacaatataactccaagacgagggccacccacctacagggctgatgatgaagtg
atctgcacctcctattattccagattggtgccacttgagcatggagagattcatacatca
ctcatcaatggcagaccaagcgctgacgatctttcacccaagttgttggaattcacttct
gcacgatatattcgccttcgcttgcaacgcattagaacgctcaatgcagatctcatgacc
cttagccaccgggaacctaaagaactggatcctattgttaccagacgctattattattca
ataaaggacatttctgttggaggcatgtgtatctgctatggccatgctagtagctgccca
tgggatgaaactacaaagaaactgcagtgtcaatgtgagcataatacttgcggggagagc
tgtaacaggtgctgtcctgggtaccatcagcagccctggaggccgggaaccgtgtcctcc
ggcaatacatgtgaagcatgtaattgtcacaataaagccaaagactgttactatgatgaa
agtgttgcaaagcagaagaaaagtttgaatactgctggacagttcagaggaggaggggtt
tgcataaattgcttgcagaacaccatgggaatcaactgtgaaacctgtattgatggatat
tatagaccacacaaagtgtctccttatgaggatgagccttgccgcccctgtaattgtgac
cctgtggggtccctcagttctgtctgtattaaggatgacctccattctgacttacacaat
gggaagcagccaggtcagtgcccatgtaaggaaggttatacaggagaaaaatgtgatcgc
tgccaacttggctataaggattacccgacctgtgtctcctgtgggtgcaacccagtgggc
agtgccagtgatgagccctgcacagggccctgtgtttgtaaggaaaacgttgaggggaag
gcctgtgatcgctgcaagccaggattctataacttgaaggaaaaaaacccccggggctgc
tccgagtgcttctgctttggcgtttctgatgtctgcagcagcctctcttggcctgttggt
caggtaaacagtatgtccgggtggctggtcaccgacttgatcagtcccaggaagatcccg
tctcagcaagatgcactaggcgggcgccatcaggtcagcatcaacaacaccgcggtcatg
cagagactggctcccaagtactactgggcagcccccgaggcctaccttggaaataagctg
actgcgtttggcggattcctgaaatacacggtgtcctacgatattccggtagagacggta
gacagtaacctcatgtcgcatgctgacgtcatcattaagggaaacggactcactttaagc
acacaggctgagggtctgtcattgcagccttatgaagagtacctaaacgtggttagactt
gtgcctgaaaacttccaagattttcacagcaaaaggcagattgatcgtgaccagctgatg
actgtccttgccaatgtgacacatcttttgatcagagccaactacaattctgcaaaaatg
gctctttacaggttggagtccgtctctctggacatagccagctctaatgccatcgacctg
gtggtggccgctgatgtggagcactgtgaatgtccgcaaggctacacagggacctcctgt
gagtcgtgcctctctggctattaccgcgtggatggaatactctttggaggaatttgtcaa
ccctgtgaatgccacggccatgcagctgagtgtaatgttcacggcgtttgcattgcgtgt
gcgcacaacaccaccggcgtccactgtgagcagtgcttgcccggcttctacggggagcct
tcccgagggacacctggggactgccagccctgcgcctgccctctcaccatagcctccaac
aatttcagccccacctgccacctcaatgatggagatgaagtggtctgtgactggtgtgcc
ccgggctactcaggagcttggtgtgagagatgtgcagatggttactatggaaacccaaca
gtgcctggcgaatcttgtgttccctgtgactgcagcggcaacgtggacccctcggaggct
ggtcactgtgactcagtcaccggggagtgcctgaagtgcctggggaacacagatggcgcc
cactgtgaaaggtgtgctgacgggttctatggggacgctgtgacagccaagaactgccgc
gcctgtgaatgccatgtgaaaggctcccattctgccgtgtgccatcttgagaccgggctc
tgtgactgcaaaccaaacgtgactggacagcagtgtgaccagtgcttgcatggctattat
gggctggactcaggccatggctgccggccctgcaactgcagcgtggcaggctccgtgtca
gatggctgcacggatgaaggccagtgtcactgtgtcccaggtgtggcagggaaaaggtgt
gacaggtgtgcccatggcttctacgcctaccaggatggtagctgtacaccctgtgactgc
ccacacactcagaatacctgcgacccagaaactggagagtgtgtctgcccccctcacaca
cagggtgtgaagtgtgaagaatgtgaggatgggcactggggctacgatgcggaggtgggg
tgccaggcctgcaattgcagtctcgtggggtcgactcatcatcggtgcgatgtggtcacc
ggccattgccagtgcaagtcaaaatttggtggccgggcctgcgatcagtgttccttgggt
tacagagactttcccgactgtgttccctgtgactgtgacctgagggggacgtcgggggac
gcctgcaacctggagcagggtctctgcggctgtgtggaggaaaccggggcctgcccttgc
aaggaaaatgtctttggtcctcagtgcaacgaatgtcgagagggcaccttcgctctccgc
gcagacaaccccctgggctgcagcccgtgcttctgctccgggctgtcccacctctgctca
gagctggaggactacgtgaggaccccagtaacgctgggctccgatcagcctcttctgcgt
gtggtttctcagagtaacttgaggggcacgaccgagggggtttactaccaggcccccgac
ttcctgctggatgccgccaccgtccggcagcacatccgtgcagagccgttttactggcgg
ctgccgcagcagttccaaggagaccagctcatggcctatggtggcaaactgaagtacagc
gtggccttctattctttggatggcgtcggcacctccaattttgagcctcaagttctcatc
aaaggtggtcggatcagaaagcaagtcatttacatggatgcaccagccccagagaatgga
gtgagacaggaacaagaagtagcaatgagagagaatttttggaaatattttaactctgtt
tctgaaaaacctgtcacgcgagaggattttatgtctgtcctcagcgatattgagtacatc
ctcatcaaggcatcgtatggtcaaggattacagcagagcagaatctcagacatttcaatg
gaggttggcagaaaggctgaaaagctgcacccagaagaagaggttgcatctcttttagag
aattgtgtctgtcctcctggcactgtgggattctcatgtcaggactgcgcccctgggtac
cacagagggaagctcccagcagggagtgacaggggaccacgccctctggttgctccttgt
gttccctgcagttgcaacaaccacagtgacacctgtgaccccaacaccgggaagtgtctg
aactgtggcgataacacagcaggtgaccattgtgatgtgtgtacttctggctactacggg
aaggtgactggctcagcaagtgactgtgctctgtgtgcctgtcctcacagccctcctgcc
agttttagtcccacttgtgtcttggaaggggaccacgatttccgttgtgacgcctgtctc
ctgggctatgaaggaaaacactgtgaaaggtgctcctcaagctattatgggaaccctcaa
acaccaggtggcagttgccagaagtgtgactgcaacccgcacggctctgtccacggtgac
tgtgaccgcacatctgggcagtgcgtttgcaggctgggggcctcggggctccggtgcgat
gagtgtgaaccgaggcacattctgatggaaacagattgtgtttcctgtgatgatgagtgt
gtaggtgtgctgctgaatgacttggatgagattggtgatgccgttctttctctgaacctc
actggcattatccctgtcccatatggaattttgtcaaacctggaaaatacaactaaatat
ctccaggaatctttattaaaagaaaatatgcaaaaggacctgggaaaaattaagcttgaa
ggtgttgcagaagaaacggacaacctgcaaaagaagctcactaggatgttagcgagtacc
caaaaggtgaatagggcaactgagagaatcttcaaggagagtcaagacctggccatagcc
attgagaggctgcagatgagcatcacagaaattatggaaaagacaactttaaatcagact
ttggatgaagatttcctactacccaattctactcttcagaacatgcaacagaatggtaca
tctttgctagaaatcatgcagataagagacttcacacagttgcaccaaaatgccaccctt
gaactcaaggctgctgaagatttattgtcacaaattcaggaaaattaccagaagccgctg
gaagaattggaggtattgaaagaagcagcaagccacgtcctttcaaagcacaacaatgaa
ctaaaggcggctgaggcgctcgtgagggaagctgaggcaaagatgcaggaaagcaaccac
ctgctgctcatggtcaatgctaatctgagagaattcagtgataaaaagctgcatgttcaa
gaagaacaaaatctgacctcagagctcattgtccaaggaagaggattgatagatgctgct
gctgcacaaacagatgctgtacaagatgctctagagcacttagaggatcaccaggataag
ctacttttatggtctgccaaaatcaggcaccacatagatgacctggtcatgcacatgtcc
caaaggaacgcagtcgacctggtctacagagctgaggaccatgccgctgagttccagaga
ctagcagatgttctgtacagtggccttgaaaacatcagaaatgtgtccctgaatgccacc
agtgcagcctatgtccattacaacatccagagcctgattgaagaatcggaggaactggcc
agagatgctcacaggactgtgactgagacgagcctgctctcagaatcccttgtttctaac
gggaaagcggccgtgcagcgcagctccagatttctaaaagaaggcaacaacctcagcagg
aagcttccaggtattgcattggaactgagtgaattgagaaataagacaaacagatttcaa
gagaatgctgttgaaattaccaggcaaaccaatgaatcactcttgatacttagagcaatt
cctaaaggtataagagacaagggagccaaaaccaaagagctggccacgtctgcaagccag
agcgcggtgagcacgctgagggacgtggcggggctgagccaggagctgctgaacacatct
gccagcctgtccagggtcaacaccacattacgagagacacaccagcttctgcaggactcc
accatggccactctgttggctggaagaaaagtcaaagacgtggaaattcaagccaacctt
ttgtttgatcggttgaagcctttgaagatgttagaggagaatctgagcagaaacctatca
gaaattaaactgttgatcagccaggcccgcaaacaagcagcttctattaaagtcgccgtg
tctgcagacagagattgcatccgggcctaccagcctcagatttcctctaccaactacaat
accttaacactaaatgttaagacacaggaacccgataatcttctcttctacctcggtagc
agcaccgcttctgatttccttgcagtggagatgcggcgagggagagtggccttcctgtgg
gacctgggctccgggtccacacgcttggagtttccagactttcccattgatgacaacaga
tggcacagtatccatgtagccagatttggaaacattggttcactgagtgtaaaggaaatg
agctcaaatcaaaagtcaccaacaaaaacaagtaaatcccctgggacagctaatgttctg
gatgtaaacaattcaacactcatgtttgttggaggtcttggaggacaaatcaagaaatct
cctgctgtgaaggttactcattttaaaggctgcttgggggaggccttcctgaatggaaaa
tccataggcctatggaactatattgaaagggaaggcaagtgccgtgggtgcttcggaagc
tcccagaatgaagacccttccttccattttgacgggagtgggtactctgtcgtggagaag
tcacttccggctaccgtgacccagataatcatgctttttaataccttttcacctaatgga
cttcttctctacctgggttcatacggcacaaaagactttttatccatcgagctgtttcgt
ggcagagtgaaggttatgactgacctgggttcaggacccattacccttttgacagacaga
cgttataacaatggaacctggtacaaaattgccttccagcgaaaccggaagcaaggagtg
ctagcagttatcgatgcctataacaccagtaataaagaaaccaagcagggcgagactccg
ggagcatcttctgacctcaaccgcctagacaaggacccgatttatgtgggtggattacca
aggtcaagagttgtaaggagaggtgtcaccaccaaaagctttgtgggctgcatcaagaac
ctggaaatatccagatcaacctttgacttactcagaaattcctatggagtgagaaaaggc
tgtttactggagcccatccggagtgttagcttcctgaaaggcggctacattgaattgcca
cccaaatctttgtcaccagaatcagaatggctggtaacatttgccaccacgaacagcagt
ggcatcatcctggctgccctcggcggggatgtggagaagcggggtgatcgtgaggaagca
cacgtgcccttcttttccgtcatgctgatcggaggcaacattgaggtacatgtcaatcct
ggggatgggacaggcctgagaaaagctctcctgcacgctcccacgggtacctgcagtgat
ggacaagcgcattccatctccttggtcaggaatcggagaattatcactgtccaattggat
gagaacaatcctgtggaaatgaagttgggcacattagtagaaagcaggacgataaatgtg
tccaatctgtacgtcgggggaattccagagggagaggggacgtcactgctcacaatgaga
agatcgttccatggctgtatcaaaaacctgatcttcaatttggaacttttggatttcaac
agtgcagttggccatgagcaagtcgacctggacacctgctggctgtcagaaaggcctaag
ctggctcccgatgcagaggacagcaagctcttgccagagccccgggcttttccagaacag
tgtgtggtggatgcagctctggagtacgttcccggcgctcaccagtttggtctcacacaa
aacagccatttcatcttgccttttaatcagtcggctgtcagaaagaagctctcggttgag
ctaagcatccgcacgttcgcctccagcggcctgatttactacatggctcatcagaaccaa
gcagactacgctgtgctccagctgcacgggggccgcctccacttcatgtttgaccttggc
aaaggcagaacaaaggtctctcaccctgcactgctcagtgatggcaagtggcacacggtc
aagacagactatgttaaaagaaaaggcttcataactgtcgacggccgagagtctcccatg
gtgactgtggtgggagatggaaccatgctggatgtggagggtttgttctacctaggaggc
ctgccctcccagtaccaggccaggaaaattggaaatatcacccacagcatccctgcctgc
attggggatgtgacggttaacagcaaacagctggacaaggacagcccggtgtctgccttc
acggtgaacaggtgctacgcagtggcccaggaaggaacatactttgacggaagcggatat
gcagctcttgtcaaagagggctacaaagtccagtcagatgtgaacatcacactggagttt
cgaacctcctcgcagaatggcgtcctcctggggatcagcactgccaaagtggatgccatt
ggactagagcttgtggacggcaaggtcttgttccatgtcaacaatggtgctggcaggata
acagctgcatatgagcccaaaaccgccactgtgctctgtgatggaaaatggcacactctt
caagctaacaaaagcaaacaccgtatcactctgattgttgacgggaacgcagttggcgct
gaaagtccacacacccagtctacctcagtggacaccaacaatcccatttatgttggtggc
tatcctgctggtgtgaagcaaaaatgcctgcgcagccagacctcgttccgcgggtgtttg
aggaagctagctctgattaagagcccgcaggtgcagtcctttgacttcagcagagcgttc
gaactgcacggagttttccttcattcctgtcctgggaccgagtcctga

DBGET integrated database retrieval system