KEGG   Homo sapiens (human): 2872Help
Entry
2872              CDS       T01001                                 

Gene name
MKNK2, GPRK7, MNK2
Definition
MAP kinase interacting serine/threonine kinase 2 (EC:2.7.11.1)
Orthology
K04372  
MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
HIF-1 signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2872 (MKNK2)
   04066 HIF-1 signaling pathway
    2872 (MKNK2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2872 (MKNK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2872 (MKNK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   2872 (MKNK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 414 aa AA seqDB search
MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAK
KRGKKKKRGRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPG
HIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNEL
EASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCS
PISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGRCG
SDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLVRDAKQRLSAA
QVLQHPWVQGCAPENTLPTPMVLQRWDSHFLLPPHPCRIHVRPGGLVRTVTVNE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaagaaaccagccgaacttcagggtttccaccgttcgttcaaggggcagaac
cccttcgagctggccttctccctagaccagcccgaccacggagactctgactttggcctg
cagtgctcagcccgccctgacatgcccgccagccagcccattgacatcccggacgccaag
aagaggggcaagaagaagaagcgcggccgggccaccgacagcttctcgggcaggtttgaa
gacgtctaccagctgcaggaagatgtgctgggggagggcgctcatgcccgagtgcagacc
tgcatcaacctgatcaccagccaggagtacgccgtcaagatcattgagaagcagccaggc
cacattcggagcagggttttcagggaggtggagatgctgtaccagtgccagggacacagg
aacgtcctagagctgattgagttcttcgaggaggaggaccgcttctacctggtgtttgag
aagatgcggggaggctccatcctgagccacatccacaagcgccggcacttcaacgagctg
gaggccagcgtggtggtgcaggacgtggccagcgccttggactttctgcataacaaaggc
atcgcccacagggacctaaagccggaaaacatcctctgtgagcaccccaaccaggtctcc
cccgtgaagatctgtgacttcgacctgggcagcggcatcaaactcaacggggactgctcc
cctatctccaccccggagctgctcactccgtgcggctcggcggagtacatggccccggag
gtagtggaggccttcagcgaggaggctagcatctacgacaagcgctgcgacctgtggagc
ctgggcgtcatcttgtatatcctactcagcggctacccgcccttcgtgggccgctgtggc
agcgactgcggctgggaccgcggcgaggcctgccctgcctgccagaacatgctgtttgag
agcatccaggagggcaagtacgagttccccgacaaggactgggcccacatctcctgcgct
gccaaagacctcatctccaagctgctggtccgtgacgccaagcagaggctgagtgccgcc
caagtcctgcagcacccctgggttcaggggtgcgccccggagaacaccttgcccactccc
atggtcctgcagaggtgggacagtcacttcctcctccctccccacccctgtcgcatccac
gtgcgacctggaggactggtcagaaccgttactgtgaatgagtga

DBGET integrated database retrieval system