KEGG   Homo sapiens (human): 2876Help
Entry
2876              CDS       T01001                                 

Gene name
GPX1, GPXD, GSHPX1
Definition
glutathione peroxidase 1 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Disease
H00668  
Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    2876 (GPX1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2876 (GPX1)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    2876 (GPX1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    2876 (GPX1)
   05016 Huntington's disease
    2876 (GPX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     2876 (GPX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 203 aa AA seqDB search
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGA
GAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYS
RRFQTIDIEPDIEALLSQGPSCA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgctcggctagcggcggcggcggcggcggcccagtcggtgtatgccttctcg
gcgcgcccgctggccggcggggagcctgtgagcctgggctccctgcggggcaaggtacta
cttatcgagaatgtggcgtccctctgaggcaccacggtccgggactacacccagatgaac
gagctgcagcggcgcctcggaccccggggcctggtggtgctcggcttcccgtgcaaccag
tttgggcatcaggagaacgccaagaacgaagagattctgaattccctcaagtacgtccgg
cctggtggtgggttcgagcccaacttcatgctcttcgagaagtgcgaggtgaacggtgcg
ggggcgcaccctctcttcgccttcctgcgggaggccctgccagctcccagcgacgacgcc
accgcgcttatgaccgaccccaagctcatcacctggtctccggtgtgtcgcaacgatgtt
gcctggaactttgagaagttcctggtgggccctgacggtgtgcccctacgcaggtacagc
cgccgcttccagaccattgacatcgagcctgacatcgaagccctgctgtctcaagggccc
agctgtgcctag

DBGET integrated database retrieval system