KEGG   Homo sapiens (human): 2906Help
Entry
2906              CDS       T01001                                 

Gene name
GRIN2D, EB11, GluN2D, NMDAR2D, NR2D
Definition
glutamate receptor, ionotropic, N-methyl D-aspartate 2D
Orthology
K05212  
glutamate receptor ionotropic, NMDA 2D
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Long-term potentiation
Glutamatergic synapse
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Cocaine addiction
Amphetamine addiction
Nicotine addiction
Alcoholism
Drug target
Ketamine: 
Esketamine: 
Ketobemidone: 
Flupirtine: 
Memantine: 
Acamprosate: 
Methadone: 
Levomethadone: 
Dextromethorphan, combinations: 
Dextromethorphan: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
Organismal Systems; Nervous system; Long-term potentiation [PATH:hsa04720]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:hsa04713]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:hsa05014]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 1336 aa AA seqDB search
MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGP
AYAAEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDD
SRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLE
EYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVS
AQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPL
PAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESL
HRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPE
KRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSL
TINEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVT
VFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVL
VWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEK
NIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGS
GKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAE
AAPPPAKPPPPPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADG
FHRYYGPIEPQGLGLGLGEARAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPP
AGAFPGFPSPPAPPAAAATAVGPPLCRLAFEDESPPAPARWPRSDPESQPLLGPGAGGAG
GTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSESLGGASLGGLEPWWFADFPYP
YAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLPPPRHLSCSHD
GLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDL
GTRRGSAHFSSLESEV
NT seq 4011 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcgccggtggcccccgcggccctcggggccccgctaagatgctgctgctgctg
gcgctggcctgcgccagcccgttcccggaggaggcgccggggccgggcggggccggtggg
cccggcggcggcctcggcggggcgcggccgctcaacgtggcgctcgtgttctcggggccc
gcgtacgcggccgaggcggcacgcctgggcccggccgtggcggcggcggtgcgcagcccg
ggcctagacgtgcggcccgtggcgctggtgctcaacggctcggacccgcgcagcctcgtg
ctgcagctctgcgacctgctgtcggggttgcgcgtgcacggcgtggtcttcgaagacgac
tcgcgcgcgcccgccgtcgcgcccatcctcgacttcctgtcggcgcagacctcgctgccc
atcgtggccgtgcacggcggcgccgcgctcgtgctcacgcccaaggagaagggctccacc
ttcctgcagctgggctcttccaccgagcaacagcttcaggtcatctttgaggtgctggag
gagtatgactggacgtcctttgtagccgtgaccactcgtgcccctggccaccgggccttc
ctgtcctacattgaggtgctgactgacggtagtctggtgggctgggagcaccgcggagcg
ctgacgctggaccctggggcgggcgaggccgtgctcagtgcccagctccgcagtgtcagc
gcgcagatccgcctgctcttctgcgcccgagaggaggccgagcccgtgttccgcgcagct
gaggaggctggcctcactggatctggctacgtctggttcatggtggggccccagctggct
ggaggcgggggctctggggcccctggtgagccccctcttctgccaggaggcgcccccctg
cctgccgggctgtttgcagtgcgctcggctggctggcgggatgacctggctcggcgagtg
gcagctggcgtggccgtagtggccagaggtgcccaggccctgctgcgtgattatggtttc
cttcctgagctcggccacgactgtcgcgcccagaaccgcacccaccgcggcgagagtctg
cataggtacttcatgaacatcacgtgggataaccgggattactccttcaatgaggacggc
ttcctagtgaacccctccctggtggtcatctccctcaccagagacaggacgtgggaggtg
gtgggcagctgggagcagcagacgctccgcctcaagtacccgctgtggtcccgctatggt
cgcttcctgcagccagtggacgacacgcagcacctcacggtggccacgctggaggaaagg
ccgtttgtcatcgtggagcctgcagaccctatcagcggcacctgcatccgagactccgtc
ccctgccggagccagctcaaccgaacccacagccctccaccggatgccccccgcccggaa
aagcgctgctgcaagggtttctgcatcgacattctgaagcggctggcgcataccatcggc
ttcagctacgacctctacctggtcaccaatggcaagcacggaaagaagatcgatggcgtc
tggaacggcatgatcggggaggtgttctaccagcgcgcagacatggccatcggctccctc
accatcaacgaggagcgctccgagatcgtggacttctccgtccccttcgtggagaccggc
atcagcgtcatggtggcgcgcagcaatggcacggtgtccccctcggccttcctcgagccc
tacagccccgccgtgtgggtgatgatgttcgtcatgtgcctcactgtggtcgccgtcact
gttttcatcttcgagtacctcagtcctgttggttacaaccgcagcctggccacgggcaag
cgccctggcggttcaaccttcaccattgggaaatccatctggctgctctgggccctggtg
ttcaataattcggtgcccgtggagaacccccggggaaccaccagcaaaatcatggtgctg
gtgtgggccttcttcgccgtcatcttcctcgccagctacacagccaacctggccgccttc
atgatccaggaggagtacgtggatactgtgtctgggctcagtgaccgcaagttccagagg
ccccaggagcagtacccgcccctgaagtttgggaccgtgcccaacggctccacggagaag
aacatccgcagcaactatcccgacatgcacagctacatggtgcgctacaaccagccccgc
gtagaggaagcgctcactcagctcaaggcagggaagctggacgccttcatctacgatgct
gcagtgctcaattacatggcccgcaaggacgagggctgcaagcttgtcaccatcggctcc
ggcaaggtcttcgccacgacaggctatggcatcgccctgcacaagggctcccgctggaag
cggcccatcgacctggcgttgctgcagttcctgggggatgatgagatcgagatgctggag
cggctgtggctctctgggatctgccacaatgacaaaatcgaggtgatgagcagcaagctg
gacatcgacaacatggcgggcgtcttctacatgctcctggtggccatgggcctgtccctg
ctggtcttcgcctgggagcacctggtgtactggcgcctgcggcactgcctggggcccacc
caccgcatggacttcctgctggccttctccaggggcatgtacagctgctgcagcgctgag
gccgccccaccgcccgccaagcccccgccgccgccacagcccctgcccagccccgcgtac
cccgcgccgcggccggctcccgggcccgcacctttcgtgccccgcgagcgcgcctcagtg
gaccgctggcgccggaccaagggcgcggggccgccggggggcgcgggcctggccgacggc
ttccaccgctactacggccccatcgagccgcagggcctaggcctcggcctgggcgaagcg
cgcgcggcaccgcggggcgcagccgggcgcccgctgtccccgccggccgctcagcccccg
cagaagccgccgccctcctatttcgccatcgtacgcgacaaggagccagccgagcccccc
gccggcgccttccccggcttcccgtcgccgcccgcgccccccgccgccgcggccaccgcc
gtcgggccgccactctgccgcttggccttcgaggacgagagcccgccggcgcccgcgcgg
tggccgcgctcggaccccgagagccaacccctgctggggccaggcgcgggcggcgcgggg
ggcacggggggcgcaggcggaggagccccggccgctccgcccccgtgccgcgccgcgccg
cccccgtgcccttacctcgatctcgagccgtcgccgtcggactcggaggactcggagagc
ctgggcggcgcgtcgctgggcggcctggagccctggtggttcgccgacttcccttacccg
tatgccgagcgcctcgggccgccgcccggccgctactggtcggtcgacaagctcgggggc
tggcgcgccgggagctgggactacctgcccccgcgcagcggtccggccgcctggcactgt
cggcactgcgccagcctggagctgctgccgccgccgcgccatctcagctgctcgcacgat
ggcctggacggcggctggtgggcgccaccgcctccaccctgggccgccgggcccctgccc
cgacgccgggcccgctgcgggtgcccgcggtcgcacccgcaccgcccgcgggcctcgcac
cgcacgcccgccgccgccgcgccccaccaccacaggcaccggcgcgccgctgggggctgg
gacctcccgccgcccgcgcccacctcgcgctcgctcgaggacctcagctcgtgccctcgc
gccgcccctgcgcgcaggcttaccgggccctcccgccacgctcgcaggtgtccgcacgcc
gcgcactgggggccgccgctgcccacagcttcccaccggagacaccggggcggggacctg
ggcacccgcaggggctcggcgcacttctctagcctcgagtccgaggtatga

DBGET integrated database retrieval system