KEGG   Homo sapiens (human): 291Help
Entry
291               CDS       T01001                                 

Gene name
SLC25A4, AAC1, ANT, ANT_1, ANT1, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, T1
Definition
(RefSeq) solute carrier family 25 member 4
  KO
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Necroptosis
Cellular senescence
Parkinson's disease
Huntington's disease
HTLV-I infection
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
H01118  
Progressive external ophthalmoplegia (PEO)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    291 (SLC25A4)
   04022 cGMP - PKG signaling pathway
    291 (SLC25A4)
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    291 (SLC25A4)
   04218 Cellular senescence
    291 (SLC25A4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    291 (SLC25A4)
   05016 Huntington's disease
    291 (SLC25A4)
  Infectious diseases
   05166 HTLV-I infection
    291 (SLC25A4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    291 (SLC25A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   291 (SLC25A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P12235(Tbio)
UniProt: 
Position
4q35.1
AA seq 298 aa AA seqDB search
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatcacgcttggagcttcctaaaggacttcctggccgggggcgtcgccgctgcc
gtctccaagaccgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgtgtggtgaga
atccctaaggagcagggcttcctctccttctggaggggtaacctggccaacgtgatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagctcttctta
gggggtgtggatcggcataagcagttctggcgctactttgctggtaacctggcgtccggt
ggggccgctggggccacctccctttgctttgtctacccgctggactttgctaggaccagg
ttggctgctgatgtgggcaagggcgccgcccagcgtgagttccatggtctgggcgactgt
atcatcaagatcttcaagtctgatggcctgagggggctctaccagggtttcaacgtctct
gtccaaggcatcattatctatagagctgcctacttcggagtctatgatactgccaagggg
atgctgcctgaccccaagaacgtgcacatttttgtgagctggatgattgcccagagtgtg
acggcagtcgcagggctggtgtcctacccctttgacactgttcgtcgtagaatgatgatg
cagtccggccggaaaggggccgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagacgaaggagccaaggccttcttcaaaggtgcctggtccaatgtgctgaga
ggcatgggcggtgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

DBGET integrated database retrieval system