KEGG   Homo sapiens (human): 291Help
Entry
291               CDS       T01001                                 

Gene name
SLC25A4, 1, AAC1, ANT, ANT_1, ANT1, MTDPS12, PEO2, PEO3, T1
Definition
solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4
Orthology
K05863  
solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Parkinson's disease
Huntington's disease
HTLV-I infection
Disease
H00469  
Mitochondrial DNA depletion syndrome (MDS)
H01118  
Progressive external ophthalmoplegia (PEO)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    291 (SLC25A4)
   04022 cGMP - PKG signaling pathway
    291 (SLC25A4)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    291 (SLC25A4)
   05016 Huntington's disease
    291 (SLC25A4)
  Infectious diseases
   05166 HTLV-I infection
    291 (SLC25A4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    291 (SLC25A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q35
AA seq 298 aa AA seqDB search
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatcacgcttggagcttcctaaaggacttcctggccgggggcgtcgccgctgcc
gtctccaagaccgcggtcgcccccatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgtgtggtgaga
atccctaaggagcagggcttcctctccttctggaggggtaacctggccaacgtgatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagctcttctta
gggggtgtggatcggcataagcagttctggcgctactttgctggtaacctggcgtccggt
ggggccgctggggccacctccctttgctttgtctacccgctggactttgctaggaccagg
ttggctgctgatgtgggcaagggcgccgcccagcgtgagttccatggtctgggcgactgt
atcatcaagatcttcaagtctgatggcctgagggggctctaccagggtttcaacgtctct
gtccaaggcatcattatctatagagctgcctacttcggagtctatgatactgccaagggg
atgctgcctgaccccaagaacgtgcacatttttgtgagctggatgattgcccagagtgtg
acggcagtcgcagggctggtgtcctacccctttgacactgttcgtcgtagaatgatgatg
cagtccggccggaaaggggccgatattatgtacacggggacagttgactgctggaggaag
attgcaaaagacgaaggagccaaggccttcttcaaaggtgcctggtccaatgtgctgaga
ggcatgggcggtgcttttgtattggtgttgtatgatgagatcaaaaaatatgtctaa

DBGET integrated database retrieval system