KEGG   Homo sapiens (human): 29107Help
Entry
29107             CDS       T01001                                 

Gene name
NXT1, MTR2, P15
Definition
nuclear transport factor 2-like export factor 1
Orthology
K14285  
NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
mRNA surveillance pathway
Influenza A
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    29107 (NXT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20p12-p11.2
AA seq 140 aa AA seqDB search
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

DBGET integrated database retrieval system