KEGG   Homo sapiens (human): 2911Help
Entry
2911              CDS       T01001                                 

Gene name
GRM1, GPRC1A, MGLU1, MGLUR1, PPP1R85, SCAR13
Definition
glutamate receptor, metabotropic 1
Orthology
K04603  
metabotropic glutamate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
FoxO signaling pathway
Neuroactive ligand-receptor interaction
Gap junction
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Long-term depression
Estrogen signaling pathway
Disease
H00063  
Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    2911 (GRM1)
   04020 Calcium signaling pathway
    2911 (GRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2911 (GRM1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    2911 (GRM1)
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2911 (GRM1)
  Nervous system
   04724 Glutamatergic synapse
    2911 (GRM1)
   04720 Long-term potentiation
    2911 (GRM1)
   04730 Long-term depression
    2911 (GRM1)
   04723 Retrograde endocannabinoid signaling
    2911 (GRM1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2911 (GRM1)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2911 (GRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q24
AA seq 1194 aa AA seqDB search
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggctccttttgttttttttcccagcgatctttttggaggtgtcccttctcccc
agaagccccggcaggaaagtgttgctggcaggagcgtcgtctcagcgctcggtggccaga
atggacggagatgtcatcattggagccctcttctcagtccatcaccagcctccggccgag
aaagtgcccgagaggaagtgtggggagatcagggagcagtatggcatccagagggtggag
gccatgttccacacgttggataagatcaacgcggacccggtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcttccgtggctctggaacagagcatt
gagttcattagggactctctgatttccattcgagatgagaaggatgggatcaaccggtgt
ctgcctgacggccagtccctccccccaggcaggactaagaagcccattgcgggagtgatc
ggtcccggctccagctctgtagccattcaagtgcagaacctgctccagctcttcgacatc
ccccagatcgcttattcagccacaagcatcgacctgagtgacaaaactttgtacaaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggccatgcttgacatagtcaaa
cgttacaattggacctatgtctctgcagtccacacggaagggaattatggggagagcgga
atggacgctttcaaagagctggctgcccaggaaggcctctgtatcgcccattctgacaaa
atctacagcaacgctggggagaagagctttgaccgactcttgcgcaaactccgagagagg
cttcccaaggctagagtggtggtctgcttctgtgaaggcatgacagtgcgaggactcctg
agcgccatgcggcgccttggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacgata
aagctgcagtctccagaggtcaggtcatttgatgattatttcctgaaactgaggctggac
actaacacgaggaatccctggttccctgagttctggcaacatcggttccagtgccgcctt
ccaggacaccttctggaaaatcccaactttaaacgaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgccctctgccctggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaagctgctggacttcctcatcaagtcctcattcatt
ggagtatctggagaggaggtgtggtttgatgagaaaggagacgctcctggaaggtatgat
atcatgaatctgcagtacactgaagctaatcgctatgactatgtgcacgttggaacctgg
catgaaggagtgctgaacattgatgattacaaaatccagatgaacaagagtggagtggtg
cggtctgtgtgcagtgagccttgcttaaagggccagattaaggttatacggaaaggagaa
gtgagctgctgctggatttgcacggcctgcaaagagaatgaatatgtgcaagatgagttc
acctgcaaagcttgtgacttgggatggtggcccaatgcagatctaacaggctgtgagccc
attcctgtgcgctatcttgagtggagcaacatcgaatccattatagccatcgccttttca
tgcctgggaatccttgttaccttgtttgtcaccctaatctttgtactgtaccgggacaca
ccagtggtcaaatcctccagtcgggagctctgctacatcatcctagctggcatcttcctt
ggttatgtgtgcccattcactctcattgccaaacctactaccacctcctgctacctccag
cgcctcttggttggcctctcctctgcgatgtgctactctgctttagtgactaaaaccaat
cgtattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccaggttc
atgagtgcctgggctcaggtgatcattgcctcaattctgattagtgtgcaactaaccctg
gtggtaaccctgatcatcatggaaccccctatgcccattctgtcctacccaagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtggtggcccctttgggctacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaacgaggccaaatatatcgcgttcaccatgtacaccacctgtatcatctggctagct
tttgtgcccatttactttgggagcaactacaagatcatcacaacttgctttgcagtgagt
ctcagtgtaacagtggctctggggtgcatgttcactcccaagatgtacatcattattgcc
aagcctgagaggaatgtccgcagtgccttcaccacctctgatgttgtccgcatgcatgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacatcttccgaagaaagaag
gcaggggcagggaatgccaattctaatggcaagtctgtgtcatggtctgaaccaggtgga
ggacaggtgcccaagggacagcatatgtggcaccgcctctctgtgcacgtgaagaccaat
gagacggcctgcaaccaaacagccgtcatcaagcccctcactaaaagttaccaaggctct
ggcaagagcctgaccttttcagataccagcaccaagaccctttacaacgtagaggaggag
gaggatgcccagccgattcgctttagcccgcctggtagcccttccatggtggtgcacagg
cgcgtgccaagcgcggcgaccactccgcctctgccgtcccacctgaccgcagaggagacc
cccctcttcctggccgaaccagccctccccaagggcttgccccctcctctccagcagcag
cagcaaccccctccacagcagaaatcgctgatggaccagctccagggagtggtcagcaac
ttcagtaccgcgatcccggattttcacgcggtgctggcaggccccggtggtcccgggaac
gggctgcggtccctgtacccgcccccgccacctccgcagcacctgcagatgctgccgctg
cagctgagcacctttggggaggagctggtctccccgcccgcggacgacgacgacgacagc
gagaggtttaagctcctccaggagtacgtgtatgagcacgagcgggaagggaacacggaa
gaagacgaactggaagaggaggaggaggacctgcaggcggccagcaaactgaccccggat
gattcgcctgcgctgacgcctccgtcgcctttccgcgactcggtggcctcgggcagctcg
gtgcccagctcccccgtgtccgagtcggtgctctgcacccctcccaacgtatcctacgcc
tctgtcattctgcgggactacaagcaaagctcttccaccctgtaa

DBGET integrated database retrieval system