KEGG   Homo sapiens (human): 2919Help
Entry
2919              CDS       T01001                                 

Gene name
CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Definition
chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Orthology
K05505  
C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NOD-like receptor signaling pathway
TNF signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Salmonella infection
Legionellosis
Amoebiasis
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    2919 (CXCL1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2919 (CXCL1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    2919 (CXCL1)
   04062 Chemokine signaling pathway
    2919 (CXCL1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    2919 (CXCL1)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2919 (CXCL1)
   05132 Salmonella infection
    2919 (CXCL1)
   05134 Legionellosis
    2919 (CXCL1)
   05146 Amoebiasis
    2919 (CXCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21
AA seq 107 aa AA seqDB search
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgctgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg
ctgctcctgctcctggtagccgctggccggcgcgcagcaggagcgtccgtggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg
aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcggaaagcttgcctcaatcctgcatcccccatagttaagaaaatcatcgaaaagatg
ctgaacagtgacaaatccaactga

DBGET integrated database retrieval system