KEGG   Homo sapiens (human): 2923Help
Entry
2923              CDS       T01001                                 

Gene name
PDIA3, ER60, ERp57, ERp60, ERp61, GRP57, GRP58, HEL-S-269, HEL-S-93n, HsT17083, P58, PI-PLC
Definition
(RefSeq) protein disulfide isomerase family A member 3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    2923 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    2923 (PDIA3)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     2923 (PDIA3)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   2923 (PDIA3)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    2923 (PDIA3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2923 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   2923 (PDIA3)
  Exosomal proteins of bladder cancer cells
   2923 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA OST3_OST6 Thioredoxin_4 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 2923
NCBI-ProteinID: NP_005304
OMIM: 602046
HGNC: 4606
Ensembl: ENSG00000167004
Vega: OTTHUMG00000044444
Pharos: P30101(Tbio)
UniProt: P30101 V9HVY3
Structure
PDB: 

Jmol
Position
15q15.3
AA seq 505 aa AA seqDB search
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcgctgttcccgggtgtggcgctgcttcttgccgcggcccgc
ctcgccgctgcctccgacgtgctagaactcacggacgacaacttcgagagtcgcatctcc
gacacgggctctgcgggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aagagacttgcacctgagtatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgcactgccaacactaacacctgtaataaatatggagtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagcaggtgcttatgatggacctaggact
gctgatggaattgtcagccacttgaagaagcaggcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcctctatagtaggttttttc
gatgattcattcagtgaggctcactccgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttgagtctctggtgaacgagtatgatgataatgga
gagggtatcatcttatttcgtccttcacatctcactaacaagtttgaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagtttatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattgcttactatgatgtggactatgaaaagaacgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagaaattcctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatgggaaggctctggagaggttcctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtgaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgaa
ttttatgccccttggtgtggtcactgtaagaacctggagcccaagtataaagaacttggc
gagaagctcagcaaagacccaaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatatacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctatcta
caaagagaagctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system