KEGG   Homo sapiens (human): 2931Help
Entry
2931              CDS       T01001                                 

Gene name
GSK3A
Definition
(RefSeq) glycogen synthase kinase 3 alpha (EC:2.7.11.1 2.7.11.26)
  KO
K08822  
glycogen synthase kinase 3 alpha [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Dopaminergic synapse
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2931 (GSK3A)
  Nervous system
   04728 Dopaminergic synapse
    2931 (GSK3A)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2931 (GSK3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2931 (GSK3A)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  GSK family [OT]
   2931 (GSK3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 483 aa AA seqDB search
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagc
tcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcc
tccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtc
ggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggcccc
ggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtg
accacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacg
gacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagag
accagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagag
ctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctac
tccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgag
acagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctat
gtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtg
tgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaag
ctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatc
tgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatcc
atcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttc
cctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacc
cgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaa
gctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgc
tctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcac
agcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccc
cctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctc
atccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagct
ttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcact
aactcctcctga

DBGET integrated database retrieval system