KEGG   Homo sapiens (human): 2932Help
Entry
2932              CDS       T01001                                 

Gene name
GSK3B
Definition
glycogen synthase kinase 3 beta (EC:2.7.11.1 2.7.11.26)
Orthology
K03083  
glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Chemokine signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Axon guidance
Hippo signaling pathway
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Dopaminergic synapse
Insulin signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Basal cell carcinoma
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    2932 (GSK3B)
   04310 Wnt signaling pathway
    2932 (GSK3B)
   04340 Hedgehog signaling pathway
    2932 (GSK3B)
   04390 Hippo signaling pathway
    2932 (GSK3B)
   04151 PI3K-Akt signaling pathway
    2932 (GSK3B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    2932 (GSK3B)
  Cellular commiunity
   04510 Focal adhesion
    2932 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    2932 (GSK3B)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    2932 (GSK3B)
   04662 B cell receptor signaling pathway
    2932 (GSK3B)
   04062 Chemokine signaling pathway
    2932 (GSK3B)
  Endocrine system
   04910 Insulin signaling pathway
    2932 (GSK3B)
   04917 Prolactin signaling pathway
    2932 (GSK3B)
   04919 Thyroid hormone signaling pathway
    2932 (GSK3B)
   04916 Melanogenesis
    2932 (GSK3B)
  Nervous system
   04728 Dopaminergic synapse
    2932 (GSK3B)
   04722 Neurotrophin signaling pathway
    2932 (GSK3B)
  Development
   04360 Axon guidance
    2932 (GSK3B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2932 (GSK3B)
   05210 Colorectal cancer
    2932 (GSK3B)
   05217 Basal cell carcinoma
    2932 (GSK3B)
   05215 Prostate cancer
    2932 (GSK3B)
   05213 Endometrial cancer
    2932 (GSK3B)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    2932 (GSK3B)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2932 (GSK3B)
  Infectious diseases
   05166 HTLV-I infection
    2932 (GSK3B)
   05162 Measles
    2932 (GSK3B)
   05164 Influenza A
    2932 (GSK3B)
   05160 Hepatitis C
    2932 (GSK3B)
   05169 Epstein-Barr virus infection
    2932 (GSK3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2932 (GSK3B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  GSK family [OT]
   2932 (GSK3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.3
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaatcgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatactgctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgactaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcgtcagatgct
aatactggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system